CSN5

COP9 signalosome complex subunit 5

360 amino acids

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and response to hormones (By similarity). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF (By similarity). Involved in early response to iron deficiency (Probable).

Belongs to the peptidase M67A family. CSN5 subfamily.

40.037 kDa

MEPTSSAAMARQTWELENNIPAAASDPDALDAIYRYDEAAQARVQQEKPWANDPHPFRRAKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNAQADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPKDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYGMLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSVHPSNKASTSAPDSSGPEPMVEA

CSN5

COP9 signalosome complex subunit 5

360 amino acids

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and response to hormones (By similarity). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF (By similarity). Involved in early response to iron deficiency (Probable).

Belongs to the peptidase M67A family. CSN5 subfamily.

40.037 kDa

MEPTSSAAMARQTWELENNIPAAASDPDALDAIYRYDEAAQARVQQEKPWANDPHPFRRAKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNAQADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPKDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYGMLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSVHPSNKASTSAPDSSGPEPMVEA

csn5

COP9 signalosome complex subunit 5

334 amino acids

Catalytic component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes.

Belongs to the peptidase M67A family. CSN5 subfamily.

37.356 kDa

MQAAQQSWELENTISLIDPQRDALYRYDEETHKALSAARPWAKDPHYFKSIRISAVALIKMTMHARSGGSLEVMGLMQGYILPETFVVTDAFRLPVEGTETRVNAQEEANEYMVSYLQSCRDAGRMENAVGWYHSHPGYGCWLSGIDVTTQDMQQLGGPFVAVVIDPERTISAGKVDIGAFRTFPKDYTPPKEGNEDEDYQTIPLSKAEDFGAYAHQYYSLEVSFFKSSLDTELLSQLWNKYWVATLSQSPLFTTRDYGSRQMMDLSQKVRRAARGIESSGSRGGATTPKDQQLEKIVRDGQRIVSEEVKGLLAAEVKMKLFQGIGEGTQTGAS

csn5

COP9 signalosome complex subunit 5

334 amino acids

Catalytic component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes.

Belongs to the peptidase M67A family. CSN5 subfamily.

37.356 kDa

MQAAQQSWELENTISLIDPQRDALYRYDEETHKALSAARPWAKDPHYFKSIRISAVALIKMTMHARSGGSLEVMGLMQGYILPETFVVTDAFRLPVEGTETRVNAQEEANEYMVSYLQSCRDAGRMENAVGWYHSHPGYGCWLSGIDVTTQDMQQLGGPFVAVVIDPERTISAGKVDIGAFRTFPKDYTPPKEGNEDEDYQTIPLSKAEDFGAYAHQYYSLEVSFFKSSLDTELLSQLWNKYWVATLSQSPLFTTRDYGSRQMMDLSQKVRRAARGIESSGSRGGATTPKDQQLEKIVRDGQRIVSEEVKGLLAAEVKMKLFQGIGEGTQTGAS

csn5

COP9 signalosome complex subunit 5

332 amino acids

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligasew complexes, leading to modify the Ubl ligase activity. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. Csn5 is essential for growth or survival.

Belongs to the peptidase M67A family. CSN5 subfamily.

37.889 kDa

MSKNGAADALKTFELENNIQTIDHDQLFKYDPQQYQQFLQSKPWSKDPHYFKHVKISAIALLKMVMHARSGGKLEVMGMLMGKVENNTMIIMDSFALPVEGTETRVNAQVEAYEYMVEYLELIKQTGRLENALGWYHSHPGYGCWLSGIDVGTQSVNQQYSEPWLGIVIDPTRTVSAGKVEIGAFRTYPQGYKPPNEGPSEYQSIPLSKIEDFGVHCKQYYSLEITYFKSSLDQQLLDKLWNKYWVNTLSSSPIFSNRDYITGQINDLSEKLEQAETQLSHSRSSILDKKKEESLLSKVSKDSSKVTIEQVQGIMSQVFKNSIFNECQTTKQ

csn5

COP9 signalosome complex subunit 5

332 amino acids

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligasew complexes, leading to modify the Ubl ligase activity. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. Csn5 is essential for growth or survival.

Belongs to the peptidase M67A family. CSN5 subfamily.

37.889 kDa

MSKNGAADALKTFELENNIQTIDHDQLFKYDPQQYQQFLQSKPWSKDPHYFKHVKISAIALLKMVMHARSGGKLEVMGMLMGKVENNTMIIMDSFALPVEGTETRVNAQVEAYEYMVEYLELIKQTGRLENALGWYHSHPGYGCWLSGIDVGTQSVNQQYSEPWLGIVIDPTRTVSAGKVEIGAFRTYPQGYKPPNEGPSEYQSIPLSKIEDFGVHCKQYYSLEITYFKSSLDQQLLDKLWNKYWVNTLSSSPIFSNRDYITGQINDLSEKLEQAETQLSHSRSSILDKKKEESLLSKVSKDSSKVTIEQVQGIMSQVFKNSIFNECQTTKQ

CSN5

COP9 signalosome complex subunit 5

327 amino acids

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis. Also involved in regulation of axis formation by checkpoint-dependent, translational control of Gurken.

Belongs to the peptidase M67A family. CSN5 subfamily.

37.083 kDa

MDSDAAQKTWELENNIQTLPSCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKVGLGK

CSN5

COP9 signalosome complex subunit 5

327 amino acids

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis. Also involved in regulation of axis formation by checkpoint-dependent, translational control of Gurken.

Belongs to the peptidase M67A family. CSN5 subfamily.

37.083 kDa

MDSDAAQKTWELENNIQTLPSCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKVGLGK

csn5

COP9 signalosome complex subunit 5

299 amino acids

Catalytic Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes.

Belongs to the peptidase M67A family. CSN5 subfamily.

34.394 kDa

MNNQLENVFRFDEEKERAKIRESPWKHDPEFFRSVKISAVALLKMLRHVSQGMPLEVMGYVQGKVEGASLIILDSFALPVEGTETRVNAHEEAQEYSVQYHTLCKSVYRHENVIGWYHSHPNYGCWLSGVDVETQRQNQKYQDPFVAVVLDPKRSLESPYVNIGAFRTYPVGNDGSIRTKSRHHPSVLFKNLPSSKIEDAGAHAEAYYSLPITYFHSKAEKKVTEFLRNRNWSRSITECSILQNNEFLHDSEKLIDHLIHETGNNELPVASAYEQSKACCNELSTFLSQIDVQDKLFKE

csn5

COP9 signalosome complex subunit 5

299 amino acids

Catalytic Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes.

Belongs to the peptidase M67A family. CSN5 subfamily.

34.394 kDa

MNNQLENVFRFDEEKERAKIRESPWKHDPEFFRSVKISAVALLKMLRHVSQGMPLEVMGYVQGKVEGASLIILDSFALPVEGTETRVNAHEEAQEYSVQYHTLCKSVYRHENVIGWYHSHPNYGCWLSGVDVETQRQNQKYQDPFVAVVLDPKRSLESPYVNIGAFRTYPVGNDGSIRTKSRHHPSVLFKNLPSSKIEDAGAHAEAYYSLPITYFHSKAEKKVTEFLRNRNWSRSITECSILQNNEFLHDSEKLIDHLIHETGNNELPVASAYEQSKACCNELSTFLSQIDVQDKLFKE