csgB

Minor curlin subunit

151 amino acids

Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. The minor subunit is the nucleation component of curlin monomers (By similarity).

Belongs to the CsgA/CsgB family.

15.882 kDa

MKNKLLFMMLTILGAPGIAAAAGYDLANSEYNFAVNELSKSSFNQAAIIGQAGTNNSAQLRQGGSKLLAVVAQEGSSNRAKIDQTGDYNLAYIDQAGSANDASISQGAYGNTAMIIQKGSGNKANITQYGTQKTAIVVQRQSQMAIRVTQR

csgB

Minor curlin subunit

151 amino acids

Curlin is the structural subunit of the curli fimbriae. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. The minor subunit is the nucleation component of curlin monomers. Coexpression of cellulose and thin aggregative fimbriae (curli fimbrae or fibers) leads to a hydrophobic network with tightly packed cells embedded in a highly inert matrix that confers cohesion, elasticity and tissue-like properties to colonies (PubMed:24097954).

Belongs to the CsgA/CsgB family.

15.882 kDa

MKNKLLFMMLTILGAPGIAAAAGYDLANSEYNFAVNELSKSSFNQAAIIGQAGTNNSAQLRQGGSKLLAVVAQEGSSNRAKIDQTGDYNLAYIDQAGSANDASISQGAYGNTAMIIQKGSGNKANITQYGTQKTAIVVQRQSQMAIRVTQR

csgB

Minor curlin subunit

151 amino acids

Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. The minor subunit is the nucleation component of curlin monomers.

Belongs to the CsgA/CsgB family.

16.182 kDa

MKNKLLFMMLTILGAPGIATATNYDLARSEYNFAVNELSKSSFNQAAIIGQVGTDNSARVRQEGSKLLSVISQEGGNNRAKVDQAGNYNFAYIEQTGNANDASISQSAYGNSAAIIQKGSGNKANITQYGTQKTAVVVQKQSHMAIRVTQR

csgB

Minor curlin subunit

151 amino acids

Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. The minor subunit is the nucleation component of curlin monomers.

Belongs to the CsgA/CsgB family.

16.254 kDa

MKNKLLFMMLTILGAPGIATATNYDLARSEYNFAVNELSKSSFNQAAIIGQVGTDNSARVRQEGSKLLSVISQEGENNRAKVDQAGNYNFAYIEQTGNANDASISQSAYGNSAAIIQKGSGNKANITQYGTQKTAVVVQKQSHMAIRVTQR

csgB

Minor curlin subunit

151 amino acids

Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin. The minor subunit is the nucleation component of curlin monomers.

Belongs to the CsgA/CsgB family.

16.182 kDa

MKNKLLFMMLTILGAPGIATATNYDLARSEYNFAVNELSKSSFNQAAIIGQVGTDNSARVRQEGSKLLSVISQEGGNNRAKVDQAGNYNFAYIEQTGNANDASISQSAYGNSAAIIQKGSGNKANITQYGTQKTAVVVQKQSHMAIRVTQR