About Services Proteins Contact

csgA

Gene
csgA
Protein
C-factor
Organism
Myxococcus xanthus
Length
166 amino acids
Function
Cell-cell signaling protein required for fruiting body morphogenesis. Necessary for cellular aggregation, for spore differentiation, and for gene expression that is initiated after 6 hour of starvation.
Similarity
To yeast YKL071W.
Mass
17.741 kDa
Sequence
MRAFATNVCTGPVDVLINNAGVSGLWCALGDVDYADMARTFTINALGPLRVTSAMLPGLRQGALRRVAHVTSRMGSLAANTDGGAYAYRMSKAALNMAVRSMSTDLRPEGFVTVLLHPGWVQTDMGGPDATLPAPDSVRGMLRVIDGLNPEHSGRFFDYQGTEVPW

Gene
csgA
Protein
Major curlin subunit
Organism
Escherichia coli O157:H7
Length
152 amino acids
Function
Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin.
Similarity
Belongs to the CsgA/CsgB family.
Mass
15.099 kDa
Sequence
MKLLKVAAIAAIVFSGSALAGVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSHMTVKQFGGGNGAAVDQTASNSTVNVTQVGFGNNATAHQY

Gene
csgA
Protein
Major curlin subunit
Organism
Salmonella enteritidis
Length
151 amino acids
Function
Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin.
Similarity
Belongs to the CsgA/CsgB family.
Mass
15.305 kDa
Sequence
MKLLKVAAFAAIVVSGSALAGVVPQWGGGGNHNGGGNSSGPDSTLSIYQYGSANAALALQSDARKSETTITQSGYGNGADVGQGADNSTIELTQNGFRNNATIDQWNAKNSDITVGQYGGNNAALVNQTASDSSVMVRQVGFGNNATANQY

Gene
csgA
Protein
Major curlin subunit
Organism
Salmonella typhi
Length
151 amino acids
Function
Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin (By similarity).
Similarity
Belongs to the CsgA/CsgB family.
Mass
15.305 kDa
Sequence
MKLLKVAAFAAIVVSGSALAGVVPQWGGGGNHNGGGNSSGPDSTLSIYQYGSANAALALQSDARKSETTITQSGYGNGADVGQGADNSTIELTQNGFRNNATIDQWNAKNSDITVGQYGGNNAALVNQTASDSSVMVRQVGFGNNATANQY

Gene
csgA
Protein
Major curlin subunit
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
151 amino acids
Function
Curlin is the structural subunit of the curli. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin.
Similarity
Belongs to the CsgA/CsgB family.
Mass
15.305 kDa
Sequence
MKLLKVAAFAAIVVSGSALAGVVPQWGGGGNHNGGGNSSGPDSTLSIYQYGSANAALALQSDARKSETTITQSGYGNGADVGQGADNSTIELTQNGFRNNATIDQWNAKNSDITVGQYGGNNAALVNQTASDSSVMVRQVGFGNNATANQY

Gene
csgA
Protein
Major curlin subunit
Organism
Escherichia coli (strain K12)
Length
151 amino acids
Function
Curlin is the structural subunit of the curli fimbriae. Curli are coiled surface structures that assemble preferentially at growth temperatures below 37 degrees Celsius. Curli can bind to fibronectin.
Similarity
Belongs to the CsgA/CsgB family.
Mass
15.049 kDa
Sequence
MKLLKVAAIAAIVFSGSALAGVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQTDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGGGNGAAVDQTASNSSVNVTQVGFGNNATAHQY

Gene
csgA
Protein
Sigma-G-dependent sporulation-specific SASP protein
Organism
Bacillus subtilis (strain 168)
Length
82 amino acids
Mass
9.838 kDa
Sequence
MDVTLGYLRESLSNHLENEVCQRICKKMLAKRYANEEEFVKDLDDNEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL