crtQ

Zeta-carotene desaturase

489 amino acids

Catalyzes the conversion of zeta-carotene to lycopene via the intermediary of neurosporene. It carries out two consecutive desaturations (introduction of double bonds) at positions C-7 and C-7' (By similarity).

Belongs to the zeta carotene desaturase family.

54.37 kDa

MRVAIVGAGLAGMATAVELVDAGHEVELYEARSFIGGKVGSWVDGDGNHIEMGLHVFFGCYYNLFNLMEKVGAKQNLRLKEHTHTFVNQGGRIGELDFRFLTGAPFNGLKAFFTTSQLDTKDKIANSIALATSPIVRGLVDFDGAMKTIRDLDRISFAEWFLSKGGNEGSLKKMWDPIAYALGFIDTENISARCMLTIFQLFAARTEASVLRMLEGSPQEYLHKPIQEYLEQRGTKFYTRHKVKEIKTKVTDGETRVTGLIINDGVETKTVTADAYVAACDVPGIKNLLPENWRTQWDFFNKIYYLDTVPVATVQLRFDGWVTEMNDPAKRKQLEQAFGLDNLLYTSDAEFSCFADLALTSPADYYRPGEGSLLQLVLTPGDPFMKESNEAIAYRVLKQVKALFPSAADLNMTWYSVIKLAQSLYREAPGMDLFRPSQATPIANFFLAGSYTQQDYIDSMEGATLSGRQAAQAILANQARLQTAVLASQ

crtQ

Zeta-carotene desaturase

479 amino acids

Catalyzes the conversion of zeta-carotene to lycopene via the intermediary of neurosporene. It carries out two consecutive desaturations (introduction of double bonds) at positions C-7 and C-7' (By similarity).

Belongs to the zeta carotene desaturase family.

53.579 kDa

MRVAIVGAGLAGLATAIDLADAGCEVQIFESRPFVGGKVGSWIDGDGNHVEMGLHVFFGCYYQLFELMNKVGAFSHLRLKEHTHTFVNKGGRTGALDFRFFTGAPFNGLKAFFTTSQLSLQDKLQNAIALGTSPIVRGLVDFEGAMKTIRNLDKISFADWFRSHGGSNGSIKRMWNPIAYALGFIDCENISARCMLTIFQFFAVRSEASVLRMLEGSPDEYLHQPILRYLEARGTKVYTRRQVREIKYAEAEGQTRVTGIVVAKGDEVEEITADAYVCACDIPGIQRVLPQEWRKWSEFDNIYKLDAVPVATVQMRFDGWVTELQDENKRKQLKEAAGLDNLLYTADADFSCFADLALTSPSDYYRQGQGSLLQLVLTPGDPFIKESNEAIAQHVLKQVYELFPSSRELNMTWYSVVKLAQSLYREAPGMDVYRPNQKTPIANFFLAGSYTQQDYIDSMEGATVSGRRAAKVILDNIKK

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.544 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.544 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.809 kDa

MTKLESLLHASTGLSLISGYLMYNRRYLLSFDKKREGETTQSISVIIPARNEEKRLPKLLKSLSQQSMRVECIVMDDDSNDRTAEIAREMGAKVYNVTYDNNGNTWIGKSYACYLGASYTVSDILIFMDADVELNNEHALEAIIQSYARQQYRGLMSIQPYHVVYKPYEHLSAMFNLMTVVGTNSFSTLSKSKGESLAFGPVTVMNKSDYILTQGHKNAASHIIEGFSLGKAFQRCQLPVTRFEGQGFVSFRMYEAGFKTMIEGWTKHLAVGASSTQPHIMMLIILWMVGCITSFSGLALSLFMKTLSFKRMALSYSLYTLQFIRLHRRVGRFSILFLAINSILFLVFILVYINSYRHIHYTKQVKWKGRQFSIK

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.544 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.544 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.348 kDa

MKWLSRILTVIVAMSMACGALIFNRRHQLKAKTLNFNHKSLTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDADGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFCMYQEGFQSLQEGWTKHLSTGAGGTKPKIMAAIVLWLFGSIASILGLCLSLKYRQMSVGKMLTVYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.544 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains.

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.544 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.574 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKTKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.574 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKTKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ

crtQ

4,4'-diaponeurosporenoate glycosyltransferase

375 amino acids

Catalyzes the glycosylation of 4,4'-diaponeurosporenoate, i.e. the esterification of glucose at the C1'' position with the carboxyl group of 4,4'-diaponeurosporenic acid, to form glycosyl-4,4'-diaponeurosporenoate. This is a step in the biosynthesis of staphyloxanthin, an orange pigment present in most staphylococci strains (By similarity).

Belongs to the glycosyltransferase 2 family. CrtQ subfamily.

42.332 kDa

MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHSIIQQQVPVDVIVMNDGSTDETACVARSYGATVVDVVDDADGKWYGKSHACYQGVTHACTNRIAFVDADVTFLRKDAVEALINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMAAIVLWLFGSIASILGLCLSLKYRQMSVGKMLTVYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYGVVEWKGRQYSISKEQ