About Services Proteins Contact

copS

Gene
copS
Protein
Sensor protein CopS
Organism
Pseudomonas syringae pv. tomato
Length
487 amino acids
Function
Member of the two-component regulatory system CopS/CopR. Involved in the activation of copper resistance gene operon copABCD. Specifically recognizes or transduces a signal only in response to copper. This would lead to phosphorylation of CopR in the cytoplasm. CopS/CopR may also regulate chromosomally encoded genes. May also be involved in basic copper metabolism.
Mass
53.457 kDa
Sequence
MKPGSLTLRLSLLFVVAVAAVLIIVGVAFNELSRHHFRALDAQALGEKLEAITQIAKESGANPELLKARWHTLLGAHPDLSAVFLKTDGTPFFAEPPQSAVPSLAQATQRDGVWEWEKEGRMFRALTASVSLPTASPPLTAWLVLDVTTHMHFFAMLERWFWGVLLASTVLSAALGWLVAKNGLRPVARVTQTAASMSAGSLKERIPLEPVPDELRALITAFNSMLGRLDDSFMRLSNFSADIAHELRTPISNLRTHTEVILAKKRAPEVYEENLSSNLEELNRLSGIIDGMLFLAKSDNGLIVPEAVELDLRTVISKLFGYYEFLAEDKGIQLQASGNASIFADSVMIDRVVSNLLSNALRYTSSGETIKVSIHDHGGRVELRLENPGPEIVPQHLDRIFDRFYRVDPARREGRECGAGASDCPVLDASAWRHYLVYIPRGPNDLHPHLHAIACPTNLTCRPDSLGTAKPGHTRLGEHETGCHCAG