About Services Proteins Contact

comH

Gene
comH
Protein
GATA zinc finger domain-containing protein 2
Organism
Dictyostelium discoideum
Length
131 amino acids
Mass
13.676 kDa
Sequence
MVKNSEHLPWYLGSDSATAASTATDATSADGAASETDAASATDTTSATDPTSATDPIATTNTTGITSSGPTTNGRRGRPYISTPPNRCYDCGRTRSPYWRKGTYNGQVVHLCNACGLNHIKIAKKSSAIFL