cmpB

Bicarbonate transport system permease protein CmpB

280 amino acids

Part of the ABC transporter complex CmpABCD involved in bicarbonate transport. Probably responsible for the translocation of the substrate across the membrane (By similarity).

Belongs to the binding-protein-dependent transport system permease family.

31.023 kDa

MTTTISQRKNRAAGANPLQKFWRKRRGDILPPIFGILGFLLLWQLISSAGLIKLPPPSSLWTDPRTRTLLMYPFYDQGGLDKGLFWQTLASLGRVAQGYSLAAIVGISTGILVGTQPLLDKALDPIFQFLRMVAPLAWVPIALVALQQNQPAAIFVIFITSVWPILINTTEGVKQIPQDYINVRKVLRLSPQKFFFKILIPSALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGFFIWDAYQQNYISEIILAVFYIGAVGLLLDRGIAYLQKLIAPGQ

cmpB

Bicarbonate transport system permease protein CmpB

278 amino acids

Part of the ABC transporter complex CmpABCD involved in bicarbonate transport. Probably responsible for the translocation of the substrate across the membrane (Probable).

Belongs to the binding-protein-dependent transport system permease family.

31.041 kDa

MVTARETRRNGSRPSGLKKWRQKLDGILLPLAGILGFLIIWQIFSSSGATRLPGPLSLFTEERTRELLLYPFLDRGGLDKGLFWQTIASLTRVAQGFSIAAIIGISVGILVGLNRQLNAMLDPLFQFLRMIAPLAWVPIALVAFQQNQPAAIFVIFITAVWPILINTAEGVRQIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMSGIVGIGFFIWDAYQQNYVSDIILAVIYIGAVGLLLDRFVAWLQRWILRNM

cmpB

Bicarbonate transport system permease protein CmpB

278 amino acids

Part of the ABC transporter complex CmpABCD involved in bicarbonate transport. Probably responsible for the translocation of the substrate across the membrane (By similarity).

Belongs to the binding-protein-dependent transport system permease family.

31.041 kDa

MVTARETRRNGSRPSGLKKWRQKLDGILLPLAGILGFLIIWQIFSSSGATRLPGPLSLFTEERTRELLLYPFLDRGGLDKGLFWQTIASLTRVAQGFSIAAIIGISVGILVGLNRQLNAMLDPLFQFLRMIAPLAWVPIALVAFQQNQPAAIFVIFITAVWPILINTAEGVRQIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVMSGIVGIGFFIWDAYQQNYVSDIILAVIYIGAVGLLLDRFVAWLQRWILRNM