cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon

397 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

41.279 kDa

MSVAFAGNSTSGSSREAGPLRVMIVDDSVVIRGLISRWVGAEHDMEVAASLRTGLEAVNQLERINPDVAVLDIEMPELDGISALPQLLAKKRDLVIIMASTLTRRNAEISFKALSLGAADYIPKPESTREASAADTFHHDLIQKIRHLGARLRRKAAVASPPLAPASPPPAARAPFVARPAAPAPAANALLPGALSTRPFSTLAPKVLLIGSSTGGPQALMALVTELGPVIDRFPVLITQHMPPTFTTILAEHLARSSRRPAAEAVDGEPVKPGRIYLAPGGKHMRVVRSGADVAIALDDGPAVNFCKPAVDPLFTSAIDIWHGAILSVILTGMGSDGMRGGKDIVAAGGSVIAQDEASSVVWGMPGAAANAGICAAILPLNQIGAKVNRLFAGDRS

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

394 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

42.665 kDa

MTVKVLVVDDSSFFRRRVSEIINADPRLEVIGNAVNGKEAVELVKKLQPDVITMDIEMPVMDGITAVREIMKVLPTPILMFSSLTQEGAKATLDALDAGALDFLPKKFEDIARNRDEAISLLQKRVGELARKRMFMRRPLRTTPAVAPASRYSAPVNAALTREAALTTAARTTAARVTPTSTTRQTMHSAVAAKPMARFKASGKKYQLMAIGTSTGGPVALQKILTQLPANFPYPIVLVQHMPATFTAAFAARLNNLSKISVKEAEDGDTLRAGVAYLAPGGKQMMLEGRPGSARLRILDGGDRMNYKPCVDVTFGSAAKVYNDKVLSMILTGMGADGREGARMLKTHGSTVWAQDEESCVVYGMPQAVAKAGISTEDLPLERFAERILVEVGR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon

391 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

40.957 kDa

MSVALAGSPATNSAQYEPLRVMIVDDSVVIRGLISRWVEAEPDMVVAASLRTGLDAVNQLERVKPDVAVLDIEMPELDGISALPQLLAKKRDLVVIMASTLTRRNAEISFKALSLGAADYIPKPETTREPQAADIFKHDLLQKIRSLGGRVRRRAVPGVAAPAIAREPHPAPLPHPAVATPTVASQAALVKRSFGPTAPRVLLIGSSTGGPQALMSMVADIGPVIDRFPVLITQHMPPTFTTILAEHLARASRRPAHEGIEGEAIKPGNIYLAPGGKHMRVAKQGGNPVIALDDGPPVNFCKPAVDPLFMSAIEVWQGGILAVVLTGMGSDGMRGGKDIVAAGGSVIAQDEASSVVWGMPGAVANAGVCAAVLPLNQIGPKVVRLFAGDRS

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

387 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

40.781 kDa

MAVKVLVVDDSGFFRRRVTEILSSDPNIVVVGTATNGKEAIEQALALKPDVITMDYEMPMMDGITAVRHIMQRIPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPQKVKQLLCEKINSISRSNRRSSGFGAASAASAAAPAAPTSSSRAPAPTTAPARAVPTRTAAPATAPAAHAHHAPAHPTTSGTPKRKAYKLVAIGTSTGGPVALQRVLTQLPASFPAPLVLIQHMPAAFTKAFAERLDKLCKISVKEAEDGDVLRPGLALLAPGGKQMMVDARGTVKILPGDERLNYKPCVDITFGSAAKSYGDKVLSVVLTGMGADGREGARLLKQAGSTVWAQDEASCVIYGMPMAIVKAELADAIYSLDDIGRHLVEACL

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

378 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

39.921 kDa

MAVKVLVVDDSGFFRRRVSEILSADPSIQVVGTATNGKEAIDQALALKPDVITMDYEMPMMDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQLLCEKVHSISRSNRRFSAYSAPAPAAAPTPAPIPAAAPSSFGSHSAPARPAPAPAPTRAPAASASSPAPKRKNYKLVAIGTSTGGPVALQRVLTQLPASFPAPIVLIQHMPAAFTKAFAERLDKLCRISVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDITFGSAAKSYSDKVLAVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKADLADAVYSLDDIGKHIVEACV

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

373 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

39.49 kDa

MAVKVLVVDDSGFFRRRVSEILSADSNIQVVGTATNGKEAIDQALALKPDVITMDYEMPMMDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQLLCEKVHSISRSNRRFSSYSAPAPQPASAPAPAPSSFASSRSPAPAPAPARAAAPAASANSPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLCRISVKEAEDGDILRPGLALLAPGGKQMMVDGRGAVKILPGDERLNYKPCVDITFGSAAKSYSDKVLAVVLTGMGADGREGARLLKQGGSAVWAQDEASCVIYGMPMAIVKANLADAVYSLDDIGRHLVEACL

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

368 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.865 kDa

MNAKIKVLLVDDSAVVRQVLQQVLERDKNIEVIGAAADPIFAQLRMSKQWPDVIVLDVEMPRMDGITFLKKLMAERPTPVVMCSTLTSKGAQTSMKALAAGAVAVVAKPAVGVKEYLESAAGELIMEIKAAAKANMRNMPAATASAQSMALPAKFSADAVIPLRTGGVIAGANKIAALGTSTGGTQALEYVLTRLPRNCPGIVIVQHMPEKFTAAFAERLNSICELEILEAESGHQVAPGRALIAPGGKHMLLRRSGAQYFVEIMSGPPVNRHRPSVDVLFRSVAQAAGRNALGVIMTGMGDDGAKGLLEMRNAGALTIGQDERSCIVYGMPKEAAKIGAVTREISLERIPQCVLDMGASLTASAQRG

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

367 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

39.075 kDa

MISVVVVDDSAFMRKALSTMLEKDPEIRVVATARDGEEGLQVIRQHNPDVVTLDIEMPRMDGLTTLRHIMMEMPRPVLMVSSLTTEGAEATLKALELGAVDFIPKQLSKVSLDIVRIENDLREKVKEVSKRRMLRTPRPVRPAPTASAPAQTAQVASAAPATAPSRPAMPATRASRPVRDVVAIGVSTGGPPAVQKVLSQLPADFPASILIAQHMPAAFTGPFAKRLDGVCAISVKEAESGEKLKPGTAYIAPGGKHLRVEQRVSHMEVVVTTDPADALYKPSANVLMESVGQSMGRRALGVILTGMGSDGMEGMKVLKQKGGRSIAQSDATCVVYGMPKAIVDAGLADEIVDIDDMAAAIMNGLYK

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

367 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

39.888 kDa

MSNQHPKKVLEMVIRALIVDDSALIRKVLSDILNQDPKIAVIGTAINGEDGLEKVRKLKPDVVLLDNIMPVLDGLKTLSHIMEEFPTPVVIVSALGEKAEEITLTALEYGAVDVIEKPSGILSQSMHEMAEEICAKVRAVSKADLNNLGCIRDLEHQIPENHRKKKNSLREKTSVRNVLAIGASTGGPRALEKLIGSFPAEIPAAVLIVQHMPPGFTASLSKRLDAKSALRVKEAQEGDIMEEGTVFIAPGDYHMEIVRNKVNGFGEDTVHLSCGPKELGSRPSVNVLFRSVARIYGPRVISLVLTGMNCDGADGAEEIKKMGGKVIAEDQSSCVIYGMPGEIVRRNLADFVLPLDKMADEIVKIVR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

366 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

39.092 kDa

MIRLLIADDSALVRKLLEGVFLEEGDFEIRTARTGLEALDMVRAFDPHVVTLDVQMPGMDGLTCLGRIMLEAPRPVVMISSLTEQNADATLSAMALGAVDVIAKPGGTFSLELDRLRPLLVATIRSAAQAKIRPTHRLADRIRHQFRDAASSPRAKAARRGAARQRAKAEPAPGLVLIGTSTGGPAALNILLPQLPADFPWPVLIAQHLPATFTGAFAKRLDRECALNVVEVDVPRQLEPGTVYIGRGDADVIVAPRPSGLIALSVPARRDYPWHPSVERMVDSALEHYDGKRLLGVLMTGMGDDGATAMTRLQALGGRTIAEAESTAVVWGMPGELVRQGGATLVLPVEEIAAAVIEWGNADAAD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon

366 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.948 kDa

MKAAADRLMAARAREGRTRVLIVDDSAMVRQALALGLSTDPRLEVVGTASGAEAARAQMAALKPDVVTLDLEMPQMDGLTFLRSYMESAPVPTVVISSLTRTSGETAMRAMEAGAVDIISKPSLGAGQGLPAIMRDVCARVWAAARARLALPDGAAPAPVAPGASEDWIHALGASTGGVQALSRILPFFPAQSPGLLVVQHMPEGFTAAFARRLDALCRMRVREAADGDLVLPGLVLIAPGGLRHMEIERAGGVCRVRLVAGAPVSYSRPSVDRMFLSLAAAAGPRVSAALLTGMGRDGAAGLLAIRRAGGRTFAQDEGSSAVFGMPLAARDLRAAEEILTLDDIPARMMLAAAADTRAPSLASND

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

365 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

39.206 kDa

MAKKIRVLIIDDSASIRQTLTHVLEQDPDIEIMAVASDPFMAARKLQEEIPDVITLDVEMPRMDGITFLRKLMSQRPIPVVMCSSLTEAGSETLLQALEAGAVDVILKSKIGAADSLSDDAMRIREVVKSASHARLSNVRRAAGTIRSASVEGPAKKLTADVMLPPPTGRAMAKTTEMVVCVGASTGGTEALREFLEELPANAPGMVIVQHMPEKFTAAFAKRLNGLCEVEVKEAVDGDPVLRGHVLIAPGDKHMLLERQGARYYVSVKTGPLVSRHRPSVDVLFRSAARSAGSNAMGIIMTGMGDDGARGMLEMHQAGAYTVAQDEASSVVFGMPKEAIAKGGVDRILPLDQIAREVLITQQKF

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

365 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.823 kDa

MKVGNTLMAARAREGRTRVLIVDDSAMVRQALALGLSTDPRLEVVGTASGAEAARAQMAALKPDVVTLDLEMPQMDGLTFLRSYMESAPVPTVVISSLTRTSGETAMRAMEAGAVDIISKPSLGAGQGLPAIMRDVCARVWAAARARLAPPDGAAPAPVATGASEDWIHALGASTGGVQALSRILPFFPAQSPGLLVVQHMPEGFTAAFARRLDALCRMRVREAADGDLVLPGLVLIAPGGLRHMEIERAGGVCRVRLVAGAPVSYSRPSVDRMFLSLAAAAGPRVSAALLTGMGRDGAAGLLAIRRAGGRTFAQDEGSSAVFGMPLAARDLRAAEEILTLDDIPARMMLAAAADTRAPSLASND

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

363 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.944 kDa

MPRKIRVLIVDDSASVRQTMTEILESDPGIEVIGTAPDPYVAARRIQQEVPDVITLDVEMPRMDGITFLRKIMAQRPIPVVVCSSLTETDSETASQAWEAGAVEIILKPRVGTAQFLLESKIHICDVVKAAAGARLRSMPAAGRANRPRVPEKKLTADAVLPPPVAGRNAMARTTESVICIGASTGGTESLREVLEALPAASPAIVIVQHMPEKFTEAFARRLDSLCDMEVKEAVDGDTVMRGRVLIAPGNHHMLLQRSGARYYVSVKDGPLVSRHRPSVDVLFRSAASHAGSNAVGIIMTGMGDDGARGLLEMRKAGAYTIAQDEATSVVFGMPKEAIALGAADKILPLEMLAMEILRAGNR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

363 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.701 kDa

MRTTPIRVLVVDDSALMRKMITQMLQKDPAIEVIGTAMDGAFGLKKIEELRPDVVTLDLEMPNMDGMEMLRHITKRGQTPVIVVSAHTTQGARETFKALQLGAFDFVAKPQEGSSLTLENVADEIIAKIKVAGAARKPRPQIATVDEALLRSARKPARPPVASRTTPSKIIAIGISTGGPNALLFMLSQLPADFAGTILIVQHMPEGFTQMFSNRLAESCAIEVKEAASGDLLLAGRALICPGNRHMRVRRMPMGDVVVLSDEPPVNGHRPSADVLFRSVAQEFGPKVVALIMTGMGEDGADAIGAVKAAGGLAVAQDEGSSVVFGMPKVAIERGNVNRVVALDALPNLLMVQSAAQRVSSFD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

360 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.865 kDa

MRKIRVVVIDDSAFNRRAIIKMLESMPEVVVAGYANDGEEGIRKVIDLKPDLVTLDLEMPKMDGFTLLRIIMGYCPTPVIVISAKSDDEKVFKALELGAVDFVAKPSQGISEELLTITDDIQQKVRGVFSLNMKEIIRREKVEVLAPPPVAPKKAEAEPRRVVPCRLDVVAIGSSTGGPPAIQRILSSFREALPLAIVISQHMPAGFTRTFAERLNRLSVFEVKEAADGDTVWPGRVLIAPGGHNMVFEKSSGSVVVRVRKPSPEDRYIPSVDAMLASCAEVFGPRTLGVVLTGMGNDGSRGVRAIKGAGGQALAEAESSAVVFGMPREAIATGVVDKVVPLDLIAREIRMRCGVATDLD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

359 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.941 kDa

MADKIKVMIVDDSALVRQVVAQALASDPGIEVTDVASDPIFALQKMKVRWPDVLVIDIEMPRMDGITFLKKIMAEHPTPTVICSSLAEKGAQATFEALAAGAVSIITKPKIGLKSFLEDASNDIVQAVRSAARANLRALSASANPAINRPKLSADAMLSTGSHRALERTTDQLVAIGTSTGGTQALEAVLTRLPATAPGIVIVQHMPEKFTAMFAERLDGLCQIEVREARNGDRVLPGLALIAPGGRHMMLKRNGAQYVVDVADGPLINRHKPSVDVLFRSVAKFAGANALGIIMTGMGDDGARGMKEMHDAGAKTIAQDESSCVVFGMPKEAIKLGGVDQTMPLQQIPGAIVGYGKSC

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

358 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.994 kDa

MPGKKISVLLVDDSAVVRQVLVAILNETPDIHVMAAASDPIFAMGKLAHEWPDVIVLDVEMPRMDGITFLKKIMSERPTPVVICSSLTQKGAETSLQALSAGAVEIITKPTTGLKNFLIESAAELVAAIRAAANSNVKNLGKRTATPVLTPASKLTADAILPAASGHSMAQTTERIVAIGTSTGGTQALEAVLTALPRVCPGIVIVQHMPEKFTASFAERLNGLSQIEVREARNNDRILPGLALIAPGGKHMMVTRSGAYYHVQVIDGPLVNRHRPSVDVLFRSVARFAGKNATGIIMTGMGDDGARGLKEMLDAGSSTVAQDEASCVVFGMPKEAIKLNAAQRIMPLQEIHQAILHR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

358 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.108 kDa

MTLETPVRVLIVDDSAVVRQMLTEILSRDPGIEVVGSAADPLLAREKIKRLNPDVITLDVEMPRMDGLVFLENLMRLRPTPVVMISSLTERGADTTLQALSLGAVDFISKPKIDVARGLEGYAEEIVSKVKMAAKAKVSALNRPSAPKITLDMQSAPVPGSALRFRTTDRLIAIGASAGGTEALRVVLEHMPADAPAVVMTQHLPASFSTAFAERLNRHSAMSVREASDGEAILPGHAYLPPGGQHLRIIRDGARWRCRIDDGPPVNRHKPAVDVLFRSVAANAGPNAVGAILTGMGDDGARGLLEMLQAGAPTLVQDEASSVVWGMPGAAYKLGAAQEVVPLERVAERLIALSAQAR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

358 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.069 kDa

MTLETPVRVLIVDDSAVVRQMLTEILSRDAGIEVVGSAADPLLAREKIKRLNPDVITLDVEMPRMDGLVFLENLMRLRPTPVVMISSLTERGADTTLQALSLGAVDFVSKPKIDVARGLEGYAEEIVSKVKMAAKAKVSALHRPSAPKVTLDMQSAPMPGSALRFRTTDRLVAIGASAGGTEALRVVLEHMPADAPAVVMTQHLPASFSTAFAERLNRHSAMSVREATDGEAILPGHAYLPPGGQHLRIIRDGARWRCRIDDGPPVNRHKPAVDVLFRSVAANAGANAVGAILTGMGDDGARGLLEMLQAGAPTLVQDEASSVVWGMPGAAYKLGAAQEVVPLDRVAERLLALSAQAR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

358 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.069 kDa

MTLETPVRVLIVDDSAVVRQMLTEILSRDAGIEVVGSAADPLLAREKIKRLNPDVITLDVEMPRMDGLVFLENLMRLRPTPVVMISSLTERGADTTLQALSLGAVDFVSKPKIDVARGLEGYAEEIVSKVKMAAKAKVSALHRPSAPKVTLDMQSAPMPGSALRFRTTDRLVAIGASAGGTEALRVVLEHMPADAPAVVMTQHLPASFSTAFAERLNRHSAMSVREATDGEAILPGHAYLPPGGQHLRIIRDGARWRCRIDDGPPVNRHKPAVDVLFRSVAANAGANAVGAILTGMGDDGARGLLEMLQAGAPTLVQDEASSVVWGMPGAAYKLGAAQEVVPLDRVAERLLALSAQAR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

356 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.923 kDa

MSIKVLIVDDSAVVRQVLSQVFTAASGIEVMDVANDPYMAMDKMKARWPDVIVLDVEMPRMDGITFLKQLMASRPTPVVICSSLTQKGTDISMQAMAAGAVEVIAKPVSGVKGFLEESSHELVMAVRSAAAARMNRVRVMPSASGNPLETRPKLSADAILSAPTGSNVFATTERIIAIGTSTGGTQALEAVLTQLPRTCPGLAIVQHMPEKFTRSFADRLNSLSQIEVKEADNGDRILPGRALIAPGGKHMMVKRSGAYYQVEVVDGPLVSRHKPSVDVLFRSAAKFAGKNALGIIMTGMGDDGAKGLKEMHDCGAKTIAQDEESCVVFGMPKEAIKLGAADEVMPLELIAKAICR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

356 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.528 kDa

MTAAKIKVLCVDDSALIRSLMTEIINSQPDMEVVGTAPDPLVAREMIKQLNPDVLTLDVEMPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKLGIRDGLMEYTDTIADKIRAASRARVRQAPQAASGTPATPMLRSPLLSTEKLIILGASTGGTEAIKDFLMPLPPDSPAVLIVQHMPAGFTRSFAQRLDGLCRITVKEAEHGERVLPGYAYIAPGDSHLRLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAEHGGKNVIGVILTGMGKDGAKGMLRMREAGAYNLAQDESTCIVFGMPKEAIAAGGVHEVVPLHSMTQRVMARLATYGTRAQRV

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

356 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.05 kDa

MARHIKVLIVDDSALVRQTLTDIFSADPELEVVGTASDPFVAVKRMETVVPDVILLDVAMPRMDGLTFLRKIMSQHPIPVVICSAVTEQGAEASFKAMEYGAVEIIQKPKVSTKQFLEESSIRICDAVKAAARAQLRKLAAKRFEVTPKLSADAMLPANAGRSVVQRTEKVVVVGASTGGTEALRVLLEAMPPDCPPIAIVQHMPEHFTAAFAGRLNSTCRIQVKEASDGDVMQRGQALIAPGNLHLLLKRSGSRYYVETKEGPLVRRHRPSVDVLFRSAARYAGNNAVAAIMTGMGDDGAAGMKELHETGAYTIAQDEATCVVYGMPHEAVKLGGVDAVLPLGALAAAIVKACNS

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

356 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.594 kDa

MTIRALVVDDSALIRKVLSDILNEDPKIRVVGTAVNGKDGLEKVIKLRPDVVLLDNVMPVLDGLKTLARIMKEQPTPVVIVSALGERAEEITLTAFEYGAVDVIEKPSGILSQSMPEMAEEICRKVRTAPKANLKNLECMRDSEPLNPEKRETKENRVLKKAAPRNILAIGASTGGPRALEKLICSLPAELPAAVLVVQHMPPGFTASLSKRLDSKSALRVKEAQEGDRVEDGTVLIAPGNYHMEIVRNKVNSLEEETIHLSCGPKELGSRPSVNVLFRSIASVYGSRVISLVLTGMNCDGADGAEEIKKMGGKVIAEARSSCVVYGMPGEIVRRNLADLVLPLDKMAEEIIRIIG

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

354 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.092 kDa

MIRVVVVDDSMSMRTLLERIINGCDGMTCVGAAEDASAAREMIRALDPDVVTLDVEMPGMDGLEFLRRMMLLKPTPTIMVSGRTTSGSDAALRALELGAVDVIAKPLLTRPADLADYARDIAELIRGAAAARVKGGALAAASSAGRERACAHRPRGAKKAGIAATRLSRVIAIGASTGGTEALRTVLQDMSGTPPPILICQHMPEGFTASFAARLDAICGIRVKEAEQGEPLHYGCAYVAPGHSHLSLAATGRLYVCRLEASPPVNRHRPSVDVLFDSVARLAGKRALGAILTGMGKDGAAGLLRMRASGARTFAQDEPSCVVFGMPKEAIAMGAVDEILPLARMGARLSEALQ

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

354 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

39.156 kDa

MSKIRVLIVDDSALMRKYLREILEQDPEIEVIAVARNGREAVEKALELSPDVITMDINMPEMDGLTAIQYIMLHRPTPIIVISSLTQKGALTTFEALELGAVDYVAKPDGTVSLKIKEVAEEILQKVKAVAKSRGVVRLKARKERPFVQEVPKTRPVSPDTSFKKLILIGVSTGGPKALMEIIPRLPGNLDASVVIIQHMPEKFTASFAARLNNYSELYVKEAEDGESLERGKVLVARGGINLKLERKLGINVVRVRYTPLPRETIYWPSVDVAFRSALTVIEPHRIIAVLLTGMGDDGAQAMVEIKQKGGYTIAESEETAVVWGMPREAIERGGASEILPVYQIADRIVELVR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

354 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.277 kDa

MKKIKVLIVDDSAVVRQTMADILASDPQIEVMATAADPFIAAERMKSDVPDVITLDVEMPRMDGITFLQKIMSQHPIPVVMCSTLTENGSETAMKALEYGAVEIIQKPKLGTKQFLEESRVRICDAIKAASQARLRKIPARPHAVAPKLSADVILEKPASRAMIQTTERVVVVGASTGGTEALRVFLESFPADCPPIVIVQHMPEGFTRAFAQRLDGICRISVKEAADNDSVIRGRALIAPGNRHMLLKRSGARYYVEIKDGPLVSRHRPSVDVLFRSAARYAGKNAVGVIMTGMGDDGASGMREMKDAGAMTIAQDEASCVVFGMPNEAIKRGGTVKVLPLESIAADVIRHCS

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

352 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.436 kDa

MIVDDSAIVRQVMQAILNKDPGIEVISAVADPIFAMNRMAIQWPDVIVLDIEMPRMDGVTFLRKIMAERPTPVVICSTLTDKGAETTMQALSAGAVSIVTKPKIGLKDFIQDAASDITNAVKAAAKANMSNIRAPKAAVKVREKNGVESLIPCGASAMSKTTEHVVAIGTSTGGTQALEFLLKALPTNAPGIVVVQHMPEKFTASFAERLDSICDIRVSEARHNDRVLPGHALIAPGGKHMMLKRSGAQYLVEIIDGPLVNRHKPSVDVLFRSTAKCAGKNAVGFILTGMGDDGARGLKDMLDAGAPTIAQDEKSCVVFGMPKEAIALGAAGKILPLAQIPQEIMRYAHLKD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

352 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.25 kDa

MVVDDSAVVRQVLVGVLNDAPGIDVIATAADPLLAIEKMRQHWPDVIVLDVEMPRMDGITFLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVVTKPRLGLKQFLTDSADELVATVRSAARANVKRLAARVTAAPLEAEVKHTADVILPAQSGRALAQTTERIVAIGTSTGGTQALEEVLTALPRVCPGIVIVQHMPEKFTAAFAARLNGLCQIAVKEAANNDRVMPGRALIAPGGKHLLLRRSGAQYFVEVLEGPPVNRHRPSVDVLFRSAARAAGSNALGIIMTGMGDDGAAGLLEMRQAGARTVAQDEHTSIVFGMPKEAIKRGGADRILPLGAMAREIVTQLQ

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

352 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.264 kDa

MVVDDSAVVRQVLVGVLNDAPGIDVIATAADPLLAIEKMRQHWPDVIVLDVEMPRMDGITFLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVVTKPRLGLKQFLTDSADELVATVRSAARANVKRLAARVTAAPLEAEVKHTADIILPAQSGRALAQTTERIVAIGTSTGGTQALEEVLTALPRVCPGIVIVQHMPEKFTAAFAARLNGLCQIAVKEAANNDRVMPGRALIAPGGKHLLLRRSGAQYFVEVLEGPPVNRHRPSVDVLFRSAARAAGSNALGIIMTGMGDDGAAGLLEMRQAGARTVAQDEHTSIVFGMPKEAIKRGGADRILPLGAMAREIVTQLQ

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

352 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.298 kDa

MVVDDSAVVRQVLVGVLNEAPGIEVIATAADPLLAIEKMRQQWPDVIVLDVEMPRMDGITFLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVVTKPRLGLKQFLTDSADELVATVRSAARANVKRLAARVTAAPLEAEVKHTADVILPAQTGRALAQTTERIVAIGTSTGGTQALEEVLTALPRVCPGIVIVQHMPEKFTAAFAARLNGLCQIAVKEAANNDRVMPGRALIAPGGKHLLLRRSGAQYFVEVLEGPPVNRHRPSVDVLFRSAARAAGSNALGIIMTGMGDDGAAGLLEMRQAGARTIAQDEHTSIVFGMPKEAIKRGGADRILPLGAMAREIVTQLQ

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

352 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.022 kDa

MRKKIKVLIVEDSLVVRELLKHIIGSDERFEVMAAVTSAEDCLEMLETQQPDVISLDIRLPGMNGLDATLKIMSRRPTPIVVVAAQVDDNELNIAMNALRAGALSVVEKPVGVTNAGYDTMAAKICTQLAIMSQVQVVRQGINRGLNFGSDDTPARVSQGRPGTYSMVGIVASTGGPQALVQLLGGLGADFPLPILLVQHITSSFLEGFVTWLSGTTPFEARIAQDGEKPVAGKVYVAPVDHHLGLVNDQLVILDLPAVCNQKPSGTVLFGSMARDIGKHGIGVVLTGMGADGSEGLRQMADKGAYTIVEDASTCVVNGMPAAAAKLGAARETLPLPAIAARLRDLALGGEK

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

352 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.118 kDa

MGKKVSVLVVDDSLICRQLICEALSKDPDIEVVGTCADGKQAVEMTKELRPHVITMDVDMPVMDGLTATEHIMAECPTPILVLTADPRSQAPELTYRALELGALALQIKPAIDAGPDAWNLVREIRLLSSVRVIRHLRRPQRGPLLPPRVATSVLPAVSMGVVVVAASTGGPQVLFKMLSELPADFPAPIVIVQHINAAFAESLAGWLAGASKLKVRLAQDGEPLMPGHVLIAPPGQHTVIPFRGRVGIKLGVERDGHMPSGTVLLESAARTYGRRAVGLVLTGMGADGADGLLAIKQAGGLAVAQNEESCVVFGMPGAAVERKAVDHLIHGDEVAATLVRLARGESLSVGR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

351 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.674 kDa

MKKIRVICVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITMRALELGAIDFVTKPRLGIRDGLLDYSELIADKIRAASRARLRGPAPVAAAALPARLRSPLNSSEKLVILGASTGGTEAIREVLLPLPPDSPAILITQHMPAGFTRSFAQRLDTLCAVTVREATHGERVLPGHVYLAPGGEQHMKLGRSGANYVIELEAGEPVNRHRPSVDVLFHSAAQAAGRNAIGVLLTGMGKDGAAGLLAMKRAGAYTLAQDEASCVVFGMPREAILLGAADEVVPLPAMSERILMRAGDRGHRV

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

351 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.618 kDa

MAIKVLVVDDSTLIRSLLGKMIESDPELSLVGMAADAYMAKDMVNQFRPDVITLDIEMPKVDGLTFLDRLMKARPTAVVMISALTEEGADATFNALALGAVDFIPKPKLDSPQGFNEYQDLILEKIKSAAKAKLLKALPSASTPVKSSIKPALSQRTVNTQLVAIGASTGGTEAILALLKQFPAVMPPIVITQHMPAGFTCTFADRLNKLTRFNVKQAEEGERLLPCYAYVAPGDQHLEIIKVGGSFKAKLSQGDKVSGHRPSVDVLFHSVAQYAGENATAVILTGMGKDGADGIEAIDMQGGKTFAQGEQSCVVFGMPKEAIKRGAIHHVVELPQLGDKLLQYLASVNRD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

351 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.878 kDa

MTIKVLVVDDSALIRNLLGQMIEADSELSLVGMAADAYMAKDMVNQHRPDVITLDIEMPKVDGLTFLDRLMKARPTAVVMISSLTEEGADATFNALALGAVDFIPKPKLDSPQDFNEYQDLILEKIKSAAHAKLKTQRAAPAVVVQPSHKPALSSRVINTQLVAIGASTGGTEAILSLLQQFPAVMPPIVITQHMPPGFTRTFAERLNKLTRLNVKQAEDGERLLPCYVYIAPGDQHLEVIKVGGSFKTRLTQGDKVSGHRPSVDVLFNSVAECAGANTTAAILTGMGKDGADGMALIDEQGGKTFAQGEQSCVVFGMPREAIKRGVIHHVVELPQLADKMLNYLASLKRD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

351 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.905 kDa

MTIKVLVVDDSALIRNLLGKMIEADSELSLVGMAADAYMAKDMVNQHRPDVITLDIEMPKVDGLTFLDRLMKARPTAVVMISSLTEEGADATFNALALGAVDFIPKPKLDSPQDFNEYQDLILEKIKSAAHAKLKTQRAAPAVVVQPSHKPALSNRVINTQLVAIGASTGGTEAILSLLQQFPAVMPPIVITQHMPPGFTRTFAERLNKLTRLNVKQAEDGERLLPCYVYIAPGDQHLEVIKVGGSFKTRLTQGDKVSGHRPSVDVLFNSVAECAGANTTAAILTGMGKDGADGMALIDEQGGKTFAQGEQSCVVFGMPREAIKRGVIHHVVELPQLADKMLNYLASLKRD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

350 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

38.184 kDa

MIRVLLVDDSPVTLMVLQSILEKEPDISVIGQAKNGKEAIILASRLAPDIITMDINMPDLDGFATTRQIMERTPVPIIIVSGIDNLEEIRASFRAVEAGALAVFRKPPAYGDPDYEEAVSEFVNAIRTYSEVKVIRRRSNHLKVPKPEASTIQIPFQIHQDIRVIVIGASTGGPQVIQEIISNLPLGFPLPLVLVQHMSPGFIEGLALWLTESTGFPVSIAREGEVLQPGKLYVAPDGIHTGVTSDLRFSFSISPPEHNLRPSVSYLFRSAAKNLGSHVLGILLSGMGSDGAEELLQIRQNGGCTIIQDRDSSFVYGMPGAAEMLNAGMFSLPPVEIARFLRSLSERRQL

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

349 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.347 kDa

MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIKQHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVDFIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIALGASTGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDRILPGHALVAPGDHHMEVQRSGANYVVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLAGLLTGMGKDGARGLLAIRQAGGYTLAQDEATCVVYGMPREAVELGAAEDVLPLERIAAALLQQAARRGSGNRL

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

348 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.97 kDa

MKPIKVLIIDDSALIRSLLREMITSDPRLEVCGAAEDPYQAREMIKQLNPHVLTLDIEMPRMNGISFLKNLMRLHPLPVVMISTLTQVGAPETLEALSLGAVDFIGKPKQHSDLGLSQYRDEIIRKLICAAGANVTAMEGVGKAKATGLDAVAQSKSLKTGFLCAIGASTGGTEAIKAVVSSLPLNSPPIVVTQHIPPAFSTSFAKRLDGASAVKVYEAQHQQPIEKGCVYIAPGDAHLKVSKTAKGYICLLDSGEMVNRHRPSVEVLFDSVCEQVGNKAMGVILTGMGADGAEALKRMRDAGSHTIAQDEATSIVWGMPGAAVKLDAAAEVLPLNKVAANIIKHALK

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

347 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.098 kDa

MRVMIVDDSAVVRGMVTRWLEEAGFIIAAIAVDGGQALRKLADTSVDVCLLDIEMPVMSGLEALPKLLAAKPDLRVIMASTLTERGAEVTLRALDLGAADYIAKPSANKLGGADLYRKDLIEKVRHLGARAARPAPPQAAPRPTLAPPSSDPAGPIEAVVVASSTGGPPALRRFIAGLGADWTSPILIAQHMPPGFTRTLAQMLDPISHLTAREAQNGEPIVPGVIYVAPGDYHMTVRAAGGGGPSIHLDQGPEVNYCRPSADPLFESAARFWKGRVLGVVLTGMGRDGRDGAAVLAKVGGTIIAQDEATSVVWGMPGAVANAGLAEAVLPLDQIGPYIASRARSVA

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

345 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.509 kDa

MVVDDSAVVRQVVAGLLADDPAIEVIAAVADPILAIARMKVQWPDVFVLDIEMPRMDGITFLKKIMAERPTPVVICSTLTEKGAQTSMAALSAGAVAIITKPKLGLKQFLVDASDDLISAVKAAARANVKRLQVVEKLTADAILPASDRHDAMLQTTERVVALGTSTGGTQALEVVLTALPRVTPGIVIVQHMPEKFTAEFANRLNGLCQITVREAKNNDRVVPGRALIAPGGKHMLLRRNGAQYSVEVLDGPLVNRHRPSVDVLFRSVARCAGANALGVIMTGMGDDGAAGLAEMRKAGARTLAQDEESCVVYGMPKEAVKRGGVERSVPLGAIAREIMAQMAG

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

345 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.727 kDa

MMSKKMKVLVVDDSPVFRALLSEIINSDPQLEVIGAAEDPYQAREMIKALKPDVLTLDIEMPKMNGVQFLKNLMRLHPLPVVMISTLTQHGADATLMALELGAVDYFPKPSVANTADMLGYRSLVNEKIRMAAQAQVGANQSMSPAVASSSAVSTSQYQLIAIGASTGGTEAVKHLLSALPASMPPIVITQHISAMFSGPFASRLDASCALSVSELTQGEVALKANHAYVAPGDKHLMVFRRGGQLYAHLDDSPAVNRHKPSVDVMFGSVAESLKGKAIGVILTGMGKDGAQGMLQMKQQGAITVAQDEQSCVVYGMPRAAVECGAAMHIKPLNKLPQFLCDLLS

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

344 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.608 kDa

MSKKIKVLVVDDSPVFRALLSEIINSDPQLEVIGAAEDPYQAREMIKALKPDVLTLDIEMPKMNGVQFLKNLMRLHPLPVVMISTLTQHGADATLMALELGAVDYFPKPSVANTADMLGYRSLVNEKIRMAAQAQVGANQSMSPAVASSSAVSTSQYQLIAIGASTGGTEAVKHLLSALPASMPPIVITQHISAMFSGPFASRLDASCALSVSELTQGEVALKTNHAYVAPGDKHLMVFRRGGQLYAHLDDSPAVNRHKPSVDVMFGSVAESLKGKAIGVILTGMGKDGAQGMLQMKQQGAITVAQDEQSCVVYGMPRAAVECGAAMHIKPLNKLPQFLCDLLS

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

343 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.651 kDa

MSKIKVLVVDDSAIVRKIFTEELSKYPDIEVVGSAPDPFVARDKIVHLKPDVITLDIEMPRMDGLTFLKKLMRHYPLPAIIVSSLTPKGGKLTLEAMDIGAVDAIAKPGSSYSVGDMSGQLVEKIRAASGARVVRKSTQEMFQPGSRLSIRSLAETSNKVIAIGASTGGTEALKNVLSRMPPDSPGILVVQHMPANFTTAFAERLNSLCQIGVKEAADNDSVTPGTALIAPGNYHMILRRSGARYYVQIKMGPMVHHQRPAVDVLFKSTAKYAGANAIGVILTGMGADGAAGLLEMKQMGAGTIAQNEKSCIVYGMPKEAVKIGAVDKIVHLDSIADEIVRMV

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

342 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.134 kDa

MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQPPDLVLMDLVMPRIDGVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDTPTLEQGGSADPSQPLLAKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGPTALTALLRRLPDDFPAALVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVLLAATNDHLHLTSRGVLAYTRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGALGLKAMRTKGHYTIAQDEATSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQRWR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

342 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.134 kDa

MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQPPDLVLMDLVMPRIDGVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDTPTLEQGGSADPSQPLLAKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGPTALTALLRRLPDDFPAALVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVLLAATNDHLHLTSRGVLAYTRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGALGLKAMRTKGHYTIAQDEATSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQRWR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

342 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

36.134 kDa

MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQPPDLVLMDLVMPRIDGVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDTPTLEQGGSADPSQPLLAKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGPTALTALLRRLPDDFPAALVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVLLAATNDHLHLTSRGVLAYTRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGALGLKAMRTKGHYTIAQDEATSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQRWR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

341 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

35.782 kDa

MSLAGGDRPIRVLVADDSELFRELLARVVAAEPGFEVAAVAADGDAAAAMARALRPDVVTMDLHMPDADGYSGIARIMAETPTPILVLTANPTEAAGFRALSLGALDILEKPSATADLGEYGRLIRSRLRLLAGVKVIRHLRGLRERRDAAPARAARVEVVVIGASLGGPRALAAVLRGLPPDFPAPIAVVQHIADGFTAGLAGWLAQESRLDVREARHGDPLRAGRVLIAPSGRHLVLGEGVARLSDAPPVDTFRPSVTPLFTSAARQYGRRCCGVLLTGMGRDGAEGLRVIKDAGGPTLAQDEATSAVFGMARAAVELGAVDRVLPVDEIPRALRELTR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

341 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

37.402 kDa

MRLRRIKTLIVDDSLLFRETLARGISRDPAIEVVATAVDAFMARDMIIKYKPDVMTLDVEMPRMSGIEFLRRLMPQYPLPVVMISALSESVFDALNAGAIDFVAKPDMNRNRDLDSFFSELILKIKIASVARLGRRAEVSKLLPTGKSQADQGWVIAIGASTGGPEAIYQIVKNFNQDTPGTVIVQHMPAGFTRMYAERLNDTCVVEVKEAQNNDQVKMGQVLIAPGEYQMRLKQKAGNYMVECHPGEKVNGHCPAVDVLFDSVAQSAGARAVGIILTGMGSDGARGLLAMRKAGARTIGQDEASCVVYGMPKVAYELGAVEKQYPLNYIGQALYKLINQL

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

339 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

35.47 kDa

MNIGIVNDLPLAVEALRRVLALRTDHRVLWVATDGDEAVDFCVAHPPDLVLMDLVMPKVDGVAATRRIMARAPCAILVVTASVSANTSSVYEAMGAGALDAVDTPTLALGLSTDASPQALLAKIDQIGRLLESRTAALVPPGPAPERGQPTLVAIGASAGGPTALTALLRALPADFPAAIVIVQHVDQAFALGMAEWLDGYTRLPVRVARQGSVPQPGEVLLAATNDHLYLSPRGVLGYTRHPVETPYRPSIDVFFNSVADGWQGEAFGVLLTGMGRDGALGLKAMRAKGCYTIAQDEATSAVYGMPKAAAAIGAASAILPLERIAPQLISRITRPLRD

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

338 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

35.253 kDa

MRIGIVNDSALAVAALRRALALDTTLEIAWIAGDGEEAVRMAATQTPDLILMDLLMPVMDGVEATRRIMAESPCAIVVVTMDLGRNANQVFDAMGHGAIDAVDTPTLTDSDTKLAAGPLLRKIRNIARLLGGRGQAPHPLAAATPTPTAPRLVAIGASAGGPAALATLLGALPADFGAAVVAVQHVDEAFAQGMAEWLDAQCQLPVRLARAGEVPQAGAVVLAGTNDHLRLTSAGRLIYTPDPCDYLYRPSIDVFFESVVEHWRGEAIGVLLTGMGRDGAQGLKAMRERGFQTIAQDQATSAVYGMPKAAATLGAASEILPLQKIAPRLVMTCGGGRR

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

336 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

35.962 kDa

MKIAIVNDMPMAIEALRRALAFEPAHQIIWVASNGADAVQRCVEQTPDLILMDLIMPVMDGVEATRRIMAETPCAIVIVTVDHEQNMRRVFEAMGHGALDVVDTPAIGGPNPKEAAAPLLRKILNIDWLIGQRVGLERVAATPRAAPSRRDRLVAIGSSAGGPAALEILLKALPVSFPAAIVLVQHVDQVFAAGMADWLSSASGLPVRLAREGETPQPGVVLLAGTNHHIRLLKDGTLAYTAEPVNEVYRPSIDVFFESVTRYWSGEAIGVLLTGMGRDGAQGLKAMRERGFLTIAQDQASSAVYGMPKAAAAIDAAVEIRPLPAIAPRLIEVFTQ

cheB2

Protein-glutamate methylesterase/protein-glutamine glutaminase 2

334 amino acids

Involved in chemotaxis. Part of a chemotaxis signal transduction system that modulates chemotaxis in response to various stimuli. Catalyzes the demethylation of specific methylglutamate residues introduced into the chemoreceptors (methyl-accepting chemotaxis proteins or MCP) by CheR. Also mediates the irreversible deamidation of specific glutamine residues to glutamic acid.

Belongs to the CheB family.

34.982 kDa

MNIGIVNDLPLAVEAMRRAIARRPEHRVLWVATDGPQAVELCAAQPPDIVLMDLIMPKFDGIEATRRIMRPERPCAILIVTSCIGANAWRVFEAMGAGALDAVDTPRLGDGAAGDTTKLLLAKIDQIGRLLDAPGSSRLAGAAARGGAGPLIAIGASAGGPGALASILGNLPADFNAPIVIVQHVDRAFAEGMAQWLDGQTRLAVRVAREGDRPQPGVALLAATDDHLRITRAGTLEYTREPAATPYRPSVDVFFNSLTEHWPGRVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATSAVYGMPKAAATLGAARAILPLGRIAGELAALARI

cheB2

Putative protein-glutamate methylesterase/protein-glutamine glutaminase

193 amino acids

May be involved in chemotaxis.

Belongs to the CheB family.

21.292 kDa

MNYEAIVIGVSAGGINAMKTILPTLPTQFGIPIVIVQHIGARSDGEWFRILEKLCNIKIKEAEEKEEIKSGMVYVAPPNYHLLIEKDKTFSFSIGERVNFSRPSIDVLFETASEVYEDKLIGVILTGANSDGAQGLKKIKENGGLAVVQDPLTAEIALMPRSAIEATSVDYVLSLEKIAELFIRLDQNNLEQR

cheB2

Putative protein-glutamate methylesterase/protein-glutamine glutaminase

193 amino acids

May be involved in chemotaxis.

Belongs to the CheB family.

21.292 kDa

MNYEAIVIGVSAGGINAMKTILPTLPTQFGIPIVIVQHIGARSDGEWFRILEKLCNIKIKEAEEKEEIKSGMVYVAPPNYHLLIEKDKTFSFSIGERVNFSRPSIDVLFETASEVYEDKLIGVILTGANSDGAQGLKKIKENGGLAVVQDPLTAEIALMPRSAIEATSVDYVLSLEKIAELFIRLDQNNLEQR