ced-9

Apoptosis regulator ced-9

280 amino acids

Plays a major role in programmed cell death (PCD, apoptosis) (PubMed:7907274, PubMed:10688797). egl-1 binds to and directly inhibits the activity of ced-9, releasing the cell death activator ced-4 from a ced-9/ced-4 containing protein complex and allowing ced-4 to activate the cell-killing caspase ced-3 (PubMed:9024666, PubMed:9027313, PubMed:9604928, PubMed:12894216, PubMed:15383288, PubMed:16208361). During larval development, required for the elimination of transient presynaptic components downstream of egl-1 and upstream of ced-4 and ced-3 apoptotic pathway (PubMed:26074078).

Belongs to the Bcl-2 family.

31.824 kDa

MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK

ced-9

Apoptosis regulator ced-9

266 amino acids

Plays a major role in programmed cell death (PCD, apoptosis). egl-1 binds to and directly inhibits the activity of ced-9, releasing the cell death activator ced-4 from a ced-9/ced-4 containing protein complex and allowing ced-4 to activate the cell-killing caspase ced-3. During larval development, required for the elimination of transient presynaptic components downstream of egl-1 and upstream of ced-4 and ced-3 apoptotic pathway.

Belongs to the Bcl-2 family.

30.64 kDa

MVDSMDMANSSQNTFRRRTMATSEMREFLSTKDAEPNNFGMQTIPESPTPSTPTRRMSIGDSTRIYDWEEPRFNIQGFVVDYFTYRIAQNGLDWYDAPALPDGVQKEHEMMRSLGTIFEKRHMEMFENFSEQLLAVPKISFSLYQEVVQTVGNSSNTPCPMSYGRLIGLISFGGMVAAKMMESAELQGQVRNLLMYTSLFIKTRIRQSWKEHNRSWADFMKLGQQMKEDYEKEKDAEEGKRLKSWSIIGASVIAVIVCGRIIFSFK