cdk9-b

Cyclin-dependent kinase 9-B

376 amino acids

Member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to production elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAP II) and SUPT5H.

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

43.249 kDa

MVKNYDSVEFPYCDEVSKYERLAKIGQGTFGEVFKAKHRQTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVHLIEICRNKISPTANQYNRCKGTIFLVFDFCEHDLAGLLSNAHVKFTVAEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNKYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPEVWPNVDKYELYQKLELPKGQKRKVKERLKAYVKDVCALDLIDKLLILDPAQRTDSDEALNHDFFWSDPMPSDLKNMLSTHNQSMFEYLAPPRRRGGHMPQQPANQARNPAATNQSEFDRVF