bfrA

Beta-fructosidase

432 amino acids

Hydrolysis of sucrose, raffinose, inulin and levan. Specific for the fructose moiety and the beta-anomeric configuration of the glycosidic linkages of its substrates. The enzyme released fructose from sucrose and raffinose, and the fructose polymer inulin is hydrolyzed quantitatively in an exo-type fashion.

Belongs to the glycosyl hydrolase 32 family.

49.841 kDa

MFKPNYHFFPITGWMNDPNGLIFWKGKYHMFYQYNPRKPEWGNICWGHAVSDDLVHWRHLPVALYPDDETHGVFSGSAVEKDGKMFLVYTYYRDPTHNKGEKETQCVAMSENGLDFVKYDGNPVISKPPEEGTHAFRDPKVNRSNGEWRMVLGSGKDEKIGRVLLYTSDDLFHWKYEGVIFEDETTKEIECPDLVRIGEKDILIYSITSTNSVLFSMGELKEGKLNVEKRGLLDHGTDFYAAQTFFGTDRVVVIGWLQSWLRTGLYPTKREGWNGVMSLPRELYVENNELKVKPVDELLALRKRKVFETAKSGTFLLDVKENSYEIVCEFSGEIELRMGNESEEVVITKSRDELIVDTTRSGVSGGEVRKSTVEDEATNRIRAFLDSCSVEFFFNDSIAFSFRIHPENVYNILSVKSNQVKLEVFELENIWL

bfrA

Bacterioferritin A

154 amino acids

Iron-storage protein, whose ferroxidase center binds Fe(2+) ions, oxidizes them by dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the protein complex.

Belongs to the bacterioferritin family.

17.961 kDa

MQGNQAVVDYMNELLSGELAARDQYFIHSRLYSEWGYTKLFERLNHEMEEETTHAEDFIRRILMLGGTPKMARAELNIGTDVVSCLKADLQTEYEVRDALKKGIKLCEEAQDYVTRDLMVAQLKDTEEDHAHWLEQQLRLIELIGEGNYYQSQL

bfrA

Bacterioferritin A

154 amino acids

Iron-storage protein, whose ferroxidase center binds Fe(2+) ions, oxidizes them by dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the protein complex.

Belongs to the bacterioferritin family.

17.947 kDa

MQGNQAVVDYMNELLSGELAARDQYFIHSRLYSEWGYTKLFERLNHEMEEETTHAEDFIRRILMLGGTPKMARAELNIGTDVVSCLKADLQTEYEVRDALKKGIKLCEEAQDYVSRDLMVAQLKDTEEDHAHWLEQQLRLIELIGEGNYYQSQL

bfrA

Bacterioferritin A

154 amino acids

Iron-storage protein, whose ferroxidase center binds Fe(2+) ions, oxidizes them by dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the protein complex.

Belongs to the bacterioferritin family.

17.961 kDa

MQGNQAVVDYMNELLSGELAARDQYFIHSRLYSEWGYTKLFERLNHEMEEETTHAEDFIRRILMLGGTPKMARAELNIGTDVVSCLKADLQTEYEVRDALKKGIKLCEEAQDYVTRDLMVAQLKDTEEDHAHWLEQQLRLIELIGEGNYYQSQL