Function
Regulates autophagy (PubMed:12958363). Together with phosphatidyl-3-phosphate kinase vps-34, acts as a core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate (PtdIns3P), thereby regulating membrane trafficking (PubMed:16111945, PubMed:21183797, PubMed:26783301). In association with sorf-1 and sorf-2, negatively regulates phosphatidylinositol 3-phosphate in early endosomes to allow for the conversion to late endosomes (PubMed:26783301). Involved in the clearance of engulfed apoptotic cell corpses (PubMed:16111945, PubMed:21183797). Together with ced-9, negatively regulates somatic and germline apoptosis (PubMed:17890369). Plays a role in endosome-to-Golgi retrograde transport of mig-14 (PubMed:21183797). In a daf-18/PTEN- and skn-1/Nrf-dependent manner, promotes germline stem cell proliferation during late and adult stages, probably by ensuring cell survival and cell cycle progression (PubMed:28285998). Required for embryonic development and L3/L4 molting during larval development (PubMed:16111945). Required for normal dauer morphogenesis and lifespan (PubMed:12958363, PubMed:17204841). Plays a role in male tail ray pattern formation (PubMed:17890369). Required for normal survival when exposed to pathogenic bacteria S.typhimurium by promoting autophagic degradation of intracellular S.typhimurium (PubMed:19667176).
Sequence
MTTQRSHICLNCQHPLRLDFTQRRPDSADSEKKSETVITEALTGHSRNLMKLISDAQFPSDAPVCNDCSDALRNEMDAQVATLDDEIKTYQTYINYLKENHPTTSIPDLKAKLQNVSDEEKELEQQLKKLLAEEEQLDLDLQTKRRTAEAASEKSGELWKKYRDNLRQVFEDQDELHSLEAERQYAEVQHRKLTDTNVLDLCFHIWVDGIVGEINGFRLGYLKDAPVEFTEINAALGQIVLLLEILLERIGVQHHELMPVAMGSHSYIKLRRNGIDMETYALYGQGTPLSGSSGIDPGIRRFLQLLEFLLKELKDRNKNFKPPYQIHADSLVDNGVKYNAVMTLNTDVRWTRAMALMLTDLKAACAQCDALRSPI