About Services Plasmids Contact

awd

Gene
awd
Protein
Nucleoside diphosphate kinase
Organism
Drosophila melanogaster
Length
153 amino acids
Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Similarity
Belongs to the NDK family.
Mass
17.17 kDa
Sequence
MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE

Gene
awd
Protein
Nucleoside diphosphate kinase
Organism
Drosophila yakuba
Length
150 amino acids
Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity).
Similarity
Belongs to the NDK family.
Mass
16.897 kDa
Fragment
single
Sequence
NKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE