About Services Plasmids Contact

aupA

Gene
aupA
Protein
Alkane uptake protein A
Organism
Marinobacter hydrocarbonoclasticus (strain ATCC 49840 / DSM 8798 / SP17)
Length
452 amino acids
Function
Required for growth on alkanes. Probably involved in the uptake of micelle-solubilized alkanes.
Similarity
Belongs to the OmpP1/FadL family.
Mass
48.605 kDa
Sequence
MSERSVYMVLSPRFSVRAVSLAVAAVSASLSMPTSASMGNLGTSYGVMPVDVATAQSLSMFNEQVSATYYNPAALTKDPRGELTAGILHSEQELRSDNPNASGDIVSDSPSQHVLIGMKTNLGSLTRFGHPIYLGFIAGVEKYGKEMLAFSSETSESGQFLQYGKEPLFLNIGGATPIWRGISAGASVRVTLEATANLDAVSTLGGETSRERLAVNAEPSLKTILGTNIDLGSTFCPESDCFLNGWETALTYRTKSSASTTVDSNIIVTQTIPDPGLSLAVTTIDSFQPETIAIGTQYSGDGWRIGGSIEQQNWSELEDEFSGDSIKDQGSVASGNRIGFDDILIPRLGAEYQLNKNFAVRGGVAYEESPLKTTRNPELNYLDTDKLVVGLGISATYDRTRLLAYPVRLDLGYQYQQLQERDFTVVDYDGDETSVTADGDIHVFSGSITLKF