About Services Plasmids Contact

auh

Gene
AUH
Protein
Methylglutaconyl-CoA hydratase, mitochondrial
Organism
Homo sapiens
Length
339 amino acids
Function
Catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA (PubMed:11738050, PubMed:12434311, PubMed:12655555). Also has itaconyl-CoA hydratase activity by converting itaconyl-CoA into citramalyl-CoA in the C5-dicarboxylate catabolism pathway (PubMed:29056341). The C5-dicarboxylate catabolism pathway is required to detoxify itaconate, a vitamin B12-poisoning metabolite (PubMed:29056341). Has very low enoyl-CoA hydratase activity (PubMed:7892223). Was originally identified as RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs (PubMed:7892223).
Similarity
Belongs to the enoyl-CoA hydratase/isomerase family.
Mass
35.609 kDa
Sequence
MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE

Gene
Auh
Protein
Methylglutaconyl-CoA hydratase, mitochondrial
Organism
Rattus norvegicus
Length
315 amino acids
Function
Catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA (By similarity). Also has itaconyl-CoA hydratase activity by converting itaconyl-CoA into citramalyl-CoA in the C5-dicarboxylate catabolism pathway (PubMed:13783048). The C5-dicarboxylate catabolism pathway is required to detoxify itaconate, a vitamin B12-poisoning metabolite (PubMed:13783048). Has very low enoyl-CoA hydratase activity (By similarity). Was originally identified as RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs (By similarity).
Similarity
Belongs to the enoyl-CoA hydratase/isomerase family.
Mass
33.341 kDa
Sequence
MAAAAAPGALGALSAGRVRLVAACCARLGSAAWARGTAPRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMHSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMALAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLAFKEKRPPRYKGE

Gene
Auh
Protein
Methylglutaconyl-CoA hydratase, mitochondrial
Organism
Mus musculus
Length
314 amino acids
Function
Catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA (By similarity). Also has itaconyl-CoA hydratase activity by converting itaconyl-CoA into citramalyl-CoA in the C5-dicarboxylate catabolism pathway (By similarity). The C5-dicarboxylate catabolism pathway is required to detoxify itaconate, a vitamin B12-poisoning metabolite (By similarity). Has very low enoyl-CoA hydratase activity (PubMed:10072761). Was originally identified as RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs (PubMed:10072761).
Similarity
Belongs to the enoyl-CoA hydratase/isomerase family.
Mass
33.395 kDa
Sequence
MAAAAPGALGALRTGRVRLVAACCARLGPAAWARGTAPRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMHSSEVGPFVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLAFKEKRPPRYKGE

Gene
auh
Protein
Methylglutaconyl-CoA hydratase, mitochondrial
Organism
Dictyostelium discoideum
Length
303 amino acids
Function
Catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA.
Similarity
Belongs to the enoyl-CoA hydratase/isomerase family.
Mass
33.245 kDa
Sequence
MIKHLIKNVSNSVKYNNVTSNNILFSTSSSLKFGRKFTTETQQECILERLEGENKGISVISFNRGHVKNALGKNLMNQFRSHLNELRFCPDTRVVIVRSLVDGVFCSGADLKERALMSQVEASQFVHSLRSSFTELETLQMPTIAAIEGVAVGGGTEMVLACDFRVASKSSKMGLPETGLAIIPGAGGTQRLPRLIGIPRAKELIFTGAILDSKRALEIGLVQYETEKGEAFDKAIEIAKQIIPKGPIAIRMAKQAIDRGMNVDQASGMIIEQASYAQVIPTKDRIEGLTAFKEKRKPIYKGE