Protein
ATP synthase subunit d, mitochondrial
Organism
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity).
Similarity
Belongs to the ATPase d subunit family.
Sequence
MSLAKSAANKLDWAKVISSLKLTGKTATQLSSFKKRNDEARRQLLELQSQPTSVDFSHYRSVLKNTEVVDKIEQFYKSYKPVSVDVSKQLSTIEAFESQAIENAAETEKLVAQELKDLKETLNNIESARPFDQLTVDELTKARPEIDAKVEEMVKKGRWDVPGYKEKFGDLTIM