arc1

Actin-related protein 2/3 complex subunit 1

377 amino acids

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Belongs to the WD repeat ARPC1 family.

41.597 kDa

MATSQVLHILPKPSYEHAFNSQRTEFVTTTATNQVELYEQDGNGWKHARTFSDHDKIVTCVDWAPKSNRIVTCSQDRNAYVYEKRPDGTWKQTLVLLRLNRAATFVRWSPNEDKFAVGSGARVISVCYFEQENDWWVSKHLKRPLRSTILSLDWHPNNVLLAAGCADRKAYVLSAYVRDVDAKPEASVWGSRLPFNTVCAEYPSGGWVHAVGFSPSGNALAYAGHDSSVTIAYPSAPEQPPRALITVKLSQLPLRSLLWANESAIVAAGYNYSPILLQGNESGWAHTRDLDAGTSKTSFTHTGNTGEGREEEGPVSFTALRSTFRNMDLKGSSQSISSLPTVHQNMIATLRPYAGTPGNITAFTSSGTDGRVVLWTL

ARC1

tRNA-aminoacylation cofactor ARC1

376 amino acids

Binds to tRNA and functions as a cofactor for the methionyl-tRNA synthetase (MetRS) and glutamyl-tRNA synthetase (GluRS). Forms a complex with MetRS and GluRS and increases their affinity for cognate tRNAs due to the presence of a tRNA binding domain in its middle and C-terminal part. Binds specifically G4 quadruplex nucleic acid structures (these are four-stranded right-handed helices, stabilized by guanine base quartets). Also required for cytoplasmic confinement of the synthetases and tRNA.

Belongs to the tRNA-aminoacylation cofactor ARC1 family.

42.084 kDa

MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEINHDLDLPHEVIEKKKKAPAGGAADAAAKADEDVSKKAKKQDHPRGKPDEETLKKLREEAKAKKAAKKAANAKQQQEQQNKAPEKPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNAKGESFKVASIANAQVR

ARC1

Arcelin-1

265 amino acids

Seed storage. This carbohydrate-binding lectin has toxic effects on an important bean bruchid pest, Z.subfasciatus. Antibiosis properties of legume lectins are proposed to be due to the lysis of epithelial cells of the intestine by binding to the carbohydrate moieties of these proteins.

Belongs to the leguminous lectin family.

29.255 kDa

MASSNLLTLALFLVLLTHANSSNDASFNVETFNKTNLILQGDATVSSEGHLLLTNVKGNEEDSMGRAFYSAPIQINDRTIDNLASFSTNFTFRINAKNIENSAYGLAFALVPVGSRPKLKGRYLGLFNTTNYDRDAHTVAVVFDTVSNRIEIDVNSIRPIATESCNFGHNNGEKAEVRITYDSPKNDLRVSLLYPSSEEKCHVSATVPLEKEVEDWVSVGFSATSGSKKETTETHNVLSWSFSSNFINFKGKKSERSNILLNKIL

Arc1

Activity-regulated cytoskeleton associated protein 1

254 amino acids

Master regulator of synaptic plasticity that self-assembles into virion-like capsids that encapsulate RNAs and mediate intercellular RNA transfer from motorneurons to muscles (PubMed:29328915). Arc1 protein is released from motorneurons in extracellular vesicles that mediate the transfer of Arc1 mRNA into muscle cells, where Arc1 mRNA can undergo activity-dependent translation (PubMed:29328915). Intercellular transfer od Arc1 mRNA is required for synaptic plasticity at the neuromuscular junction (PubMed:29328915). May play a role in energy balance: required for regulation of body fat by a specific population of brain neurons, named E347, that are necessary and sufficient for proper body fat storage (PubMed:26209258).

Belongs to the ARC/ARG3.1 family.

28.877 kDa

MAQLTQMTNEQLRELIEAVRAAAVGAAGSAAAAGGADASRGKGNFSACTHSFGGTRDHDVVEEFIGNIETYKDVEGISDENALKGISLLFYGMASTWWQGVRKEATTWKEAIALIREHFSPTKPAYQIYMEFFQNKQDDHDPIDTFVIQKRALLAQLPSGRHDEETELDLLFGLLNIKYRKHISRHSVHTFKDLLEQGRIIEHNNQEDEEQLATAKNTRGSKRTTRCTYCSFRGHTFDNCRKRQKDRQEEQHEE