AIR1

Protein AIR1

360 amino acids

Component of the TRAMP (TRF4) and TRAMP5 complexes which have a poly(A) RNA polymerase activity and are involved in a post-transcriptional quality control mechanism limiting inappropriate expression of genetic information. Polyadenylation is required for the degradative activity of the exosome on several of its nuclear RNA substrates like cryptic transcripts generated by RNA polymerase II and III, or hypomethylated pre-tRNAi-Met. Both complexes polyadenylate RNA processing and degradation intermediates of snRNAs, snoRNAs and mRNAs that accumulate in strains lacking a functional exosome. AIR1 also inhibits the methylation of NPL3 mediated by HMT1 through its interaction with HMT1.

Belongs to the AIR1 family.

41.631 kDa

MSTLLSEVESIDTLPYVKDTTPTGSDSSSFNKLLAPSIEDVDANPEELRTLRGQGRYFGITDYDSNGAIMEAEPKCNNCSQRGHLKRNCPHVICTYCGFMDDHYSQHCPKAIICTNCNANGHYKSQCPHKWKKVFCTLCNSKRHSRERCPSIWRSYLLKTKDANQGDFDFQTVFCYNCGNAGHFGDDCAERRSSRVPNTDGSAFCGDNLATKFKQHYFNQLKDYKREASQRQHFDNEHEFNLLDYEYNDDAYDLPGSRTYRDKMKWKGKVQSTRNKNSSNNRYESSNNRKKKSPFSAQNYKVTKNKRVQTHPLDFPRSSQNNRTNDYSSQFSYNRDDFPKGPKNKRGRSSSNKSQRNGRY

air1

Protein air1

315 amino acids

Component of the TRAMP (TRF4) and TRAMP5 complexes which have a poly(A) RNA polymerase activity and are involved in a post-transcriptional quality control mechanism limiting inappropriate expression of genetic information. Polyadenylation is required for the degradative activity of the exosome on several of its nuclear RNA substrates like cryptic transcripts generated by RNA polymerase II and III, or hypomethylated pre-tRNAi-Met. Both complexes polyadenylate RNA processing and degradation intermediates of snRNAs, snoRNAs and mRNAs that accumulate in strains lacking a functional exosome.

Belongs to the AIR1 family.

35.545 kDa

MDMTVSNQKAESDDGSDIDDAALLQKINSLPIDQSITNSVSLEKHDFQGSDDHDSSTDLSDSTLEDVEGSEWADVSRGRYFGSDPSESIVCHNCKGNGHISKDCPHVLCTTCGAIDDHISVRCPWTKKCMNCGLLGHIAARCSEPRKRGPRVCRTCHTDTHTSSTCPLIWRYYVEKEHPVRIDVSEVRKFCYNCASDEHFGDDCTLPSRSNYPESTAFCEANCPSGNDASNKEFFETRRKEFQLERREQNRNQKSSKQRPFHKPGNSLASRLGSKPKSFKRKHSPPSEENGNLSFHSSDGRKFTKTSKKNRKRKW

AIR1

Putative lipid-binding protein AIR1

111 amino acids

Belongs to the plant LTP family. PEARLI1 subfamily.

11.624 kDa

MAPRTPLALFVSLNLLFFTYTSATTGTCPKNSIEIGTCVTVLNLVDLTLGNPPVKPCCSLIQGLADLEAAVCLCTAVKASILGIVNINLPINLSVLLNVCSRNAPKSFQCA