About Services Proteins Contact

aaeA

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Length
321 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
35.624 kDa
Sequence
MKSFFLTLFRQQAALTKKLSRVVITLVIVLCAIVAIFRVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTDVRVTDNQLVNKGDVLFVIDQPRYHQAVAQAEADVAYYQALVTEKRRESGRRARLGVSAMSQENIDQSNNALETATHQLAKAQAVMSLAKLELDRTVVRAPADGWVTNLHVQSGEFIERGNTAVALVKKDSFYLLAYMEETKLEGVRRGYRAEITPLGSEKIFYGTVDSVAAGINNSSNSANTKGLANVDSNLEWVRLAQRVPVKIRLDRQMGDLYPAGTTATVVVTGEQVNNDKKPSPLIRLLYRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Length
321 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
35.621 kDa
Sequence
MKAFFLTLFRQQAVLIKKMSRVAITLVIVLCAIVAIFRVWAFYTESPWTRDAKFTADVVAIAPDVSGLLSDVRVTDNQLVNKGDVLFVIDQPRYHQAVAQAEADVAYYQALVTEKRRESGRRARLGISAMSQENIDQSSNALETATHQLAKAQVVLSLAQLELERTVVRAPADGWVTNLHVQSGEFIERGNTAVALVKKDSFYLLAYMEETKLEGVRRGYRAEITPLGSEKIFYGTVDSVAAGVNNSSSSANNKGLANVDSNLEWVRLAQRVPVKIRLDRQMGDLYPAGTTATVVITGEQVNNDKKPSPLIRLLYRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Serratia proteamaculans (strain 568)
Length
311 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.2 kDa
Sequence
MKNFSIKITRIAITLILVLLGIIAIFKAWVFYTESPWTRDAKFTADVVAIAPDVTGLLTDVPLVDNQLVKKGQVLLVIDQPRYQQALAEANADVAYYQTLAAEKRREAGRRVRLGVQAMSQEEIDQANNVLQTVEHQLAKAVATRELAKLDLERTTVRAPADGWITNLNVHAGEYITRGSVAVALVKKNSFYILAYLEETKLNGLNKGDRAEITPLGSNRIMHGTVDSVAAAVNNSSSTVNSKGLASIDSNLEWVRLAQRVPVKILLDDKDQLHPYPAGTTATVVITGKNDRATDSGSPFVRLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Length
311 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.24 kDa
Sequence
MSTFSLKIIRIGITLLVVLLAVIAIFKVWAFYTESPWTRDAKFTADVVAIAPDVSGLITDVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESGRRQRLGIQAMSQEEIDQSNNVLQTVRHQLAKAVAVRDLAKLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGHRAEITPLGSNRILHGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIRLDSEDQQHSYPAGTTATVVITGSTDRDPNQASPIVKLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Length
311 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.375 kDa
Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQREFSRRHLLGIQALSQEEIDQASNVLQTVQHQLAKTIAVRNLARLDLERTTIRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPMTKLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Yersinia pestis bv. Antiqua (strain Antiqua)
Length
311 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.315 kDa
Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPMTKLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Length
311 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.315 kDa
Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPMTKLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Yersinia pestis
Length
311 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.315 kDa
Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPMTKLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Yersinia pestis bv. Antiqua (strain Angola)
Length
311 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.315 kDa
Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPMTKLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.781 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITNVSVHDNQLVKKDQILFTIDQPRYKKALEEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDAKGMATIDSNLEWVRLAQRVPVRIRLDDQQDNLWPAGTTATVVITGKQDRDETQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Cronobacter sakazakii (strain ATCC BAA-894)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.508 kDa
Sequence
MKLLTTKITRTAITVVLVVLAFIAIFRAWSFYTESPWTRDARFSADVVAIAPDVAGLITSVDVHDNQLVKKDQVLFTIDQPRYQKALEEAEADVAYYQALANEKRREAGRRNQLGVQAMSREEIDQANNVLQTVLHQLAKAEATRDLAKLDLQRTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVQAYMEETKLEGVRPGFRVEITPLGSNNVLHGTVDSVSAGVTNASSTRDAKGMATVDSNLEWVRLAQRVPVRIRLDKQPGNLYPAGTTATVVVTGERDRDRSQESAFNKLMHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O139:H28 (strain E24377A / ETEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.775 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O45:K1 (strain S88 / ExPEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain 55989 / EAEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.775 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.773 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFIIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O81 (strain ED1a)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O8 (strain IAI1)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.722 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRICLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain K12 / MC4100 / BW2952)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.775 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain K12 / DH10B)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.775 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O9:H4 (strain HS)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.789 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPVDGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O1:K1 / APEC
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella heidelberg (strain SL476)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella newport (strain SL254)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella paratyphi C (strain RKS4594)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella paratyphi A (strain AKU_12601)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella schwarzengrund (strain CVM19633)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.575 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEASRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella typhi
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Shigella dysenteriae serotype 1 (strain Sd197)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Shigella flexneri serotype 5b (strain 8401)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.775 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Shigella flexneri
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.776 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSDLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Shigella sonnei (strain Ss046)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.733 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGGRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain K12)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.775 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.691 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTSDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain SE11)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain SMS-3-5 / SECEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli (strain UTI89 / UPEC)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.761 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Enterobacter sp. (strain 638)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.552 kDa
Sequence
MKTLTRNISRTAITVALVILAFIAISRAWVFYTESPWTRDARFSADIVAIAPDVAGLITAVNVRDNQLVKKDQVLFTIDQPRYQKALEESEADVAYYQALTTEKRREAGRRNKLGIQAMSREEIDQSNNLLQTVLHQLAKAEATRDLAKLDLERTVIRAPSDGWVTNLNVYTGEFITRGSTAVALVKQHSFYVLAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSIAAGVTNSSATRDSKGMATVDSNLEWVRLAQRVPVRIRLDDEQGNLWPAGTTATVVITGEKDRNASNDSLFRKIAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.481 kDa
Sequence
MKTLTRKISRTVITLLLVIIAIVLIFRIWVFYTESPWTRDAKFTADVVAIAPDVSGLISEVRVRDNQLVQKDQVLFTIDPPRYQKALDEAQADVAYYQAVMGEKRREAARRNQLGVSAMSREAIEQANNDYQTTEHQLAKAVASRDLAQLDLERTVVKAPSAGWVTNLNVYTGEFITRGSTSVALVKQNSFYVLAYLEETKLEGIRPGYRVEITPLGSNQVLRGSVDSIAAGVTNSSSTVDSKGMATIDSNLEWVRLAQRVPVRIHLDSQPGNQYPSGTTATVVVTGAQDRKDNDMPPLMKLIHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.624 kDa
Sequence
MKTLIRKLTRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITNVNVHDNQLVKKGQVLFTIDQPRYQKALAEAEADVAYYSVLAQEKRQEASRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNTFYVLAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSIAAGVTNASSTRDAKGMATIDSNLEWVRLAQRVPVRIRLDAQPENLWPAGTTATVVVTGKDDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Klebsiella pneumoniae (strain 342)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.459 kDa
Sequence
MKTLTRNILRTAITVILVILAFVAIFRAWVYYTASPWTRDARFSADIVAIAPDVSGLISQVNVKDNQLVKKDQVLFVIDQPRYQKALAEAEADVAYYQTLAQEKRVEAGRRNKLGIQAMSREEIDQANNVLQTVEHQLAKAVASRDLARLDLERTEIRAPADGWVTNLNVYTGEFITRGSTAVALVKENTFYVMAYLEETKLEGVRPGYRAEITPLGSSKTIKGTVDSIAAGVTNASSSSDSKGMASVDSNLEWVRLAQRVPVRIRLDQQQGNLWPSGTTATVVITGKEDRDTSRANFFQKLAMRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella agona (strain SL483)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.575 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEASRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.575 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVQKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNTSSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella choleraesuis (strain SC-B67)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella dublin (strain CT_02021853)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella enteritidis PT4 (strain P125109)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.545 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Length
310 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.529 kDa
Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITHVNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDPERTVIRAPADGWVTNLNVYAGEFITRGSTAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTSDAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFRKLAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O157:H7
Length
309 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.645 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG

Gene
aaeA
Protein
p-hydroxybenzoic acid efflux pump subunit AaeA
Organism
Escherichia coli O157:H7 (strain EC4115 / EHEC)
Length
309 amino acids
Function
Forms an efflux pump with AaeB.
Similarity
Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
Mass
34.645 kDa
Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQVNVHNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGSTAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRDDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRKMAHRLREFG