ZNF488

Zinc finger protein 488

340 amino acids

Transcriptional repressor. Plays a role in oligodendrocyte differentiation, together with OLIG2. Mediates Notch signaling-activated formation of oligodendrocyte precursors. Promotes differentiation of adult neural stem progenitor cells (NSPCs) into mature oligodendrocytes and contributes to remyelination following nerve injury.

Belongs to the krueppel C2H2-type zinc-finger protein family.

36.962 kDa

MPEWPPCLSVAPALVITMAAGKGAPLSPSAENRWRLSEPELGRGCKPVLLEKTNRLGPEAAVGRAGRDVGSAELALLVAPGKPRPGKPLPPKTRGEQRQSAFTELPRMKDRQVDAQAQEREHDDPTGQPGAPQLTQNIPRGPAGSKVFSVWPSGARSEQRSAFSKPTKRPAERPELTSVFPAGESADALGELSGLLNTTDLACWGRLSTPKLLVGDLWNLQALPQNAPLCSTFLGAPTLWLEHTQAQVPPPSSSSTTSWALLPPTLTSLGLSTQNWCAKCNLSFRLTSDLVFHMRSHHKKEHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS

Znf488

Zinc finger protein 488

337 amino acids

Transcriptional repressor (PubMed:16908628). Plays a role in oligodendrocyte differentiation, together with OLIG2 (PubMed:16908628, PubMed:22355521). Mediates Notch signaling-activated formation of oligodendrocyte precursors (PubMed:16908628). Promotes differentiation of adult neural stem progenitor cells (NSPCs) into mature oligodendrocytes and contributes to remyelination following nerve injury (PubMed:22355521).

Belongs to the krueppel C2H2-type zinc-finger protein family.

37.195 kDa

MAAGTSTLLSLSGPADHMAEGKGAPLRPSVEKRWKLMEPKQTQAGMFKKMSLVDSDTAAGKGSQDEAYTELSLPTAPNKPRLDRPRACKAYTEQRHNTFTELSCLQERPGDIQAQTRKLENPEGQLGPQQLPSSFLRASGDGTVCSAWPGAPRSEQKSAFSKPAKRPAEKPKRSPMLLAGGSAEGSWELSGLITTVDIPYWAHLSTFKFMGDFWKLHTLSQNILLCNAFQGAPTPWLEHTQVQAPTSSAPSSTASRALLPPTLSSLGLSTQNWCAKCNLAFRLTADLVFHMRSHHKREHVGPDPHSKKRREEVLTCPVCHEYFRERHHLSRHMASHS