YAP1

AP-1-like transcription factor YAP1

650 amino acids

Transcription activator involved in oxidative stress response and redox homeostasis. Regulates the transcription of genes encoding antioxidant enzymes and components of the cellular thiol-reducing pathways, including the thioredoxin system (TRX2, TRR1), the glutaredoxin system (GSH1, GLR1), superoxide dismutase (SOD1, SOD2), glutathione peroxidase (GPX2), and thiol-specific peroxidases (TSA1, AHP1). The induction of some of these genes requires the cooperative action of both, YAP1 and SKN7. Preferentially binds to promoters with the core binding site 5'-TTA[CG]TAA-3'. Activity of the transcription factor is controlled through oxidation of specific cysteine residues resulting in the alteration of its subcellular location. Oxidative stress (as well as carbon stress, but not increased temperature, acidic pH, or ionic stress) induces nuclear accumulation and as a result YAP1 transcriptional activity. Activation by hydrogen peroxide or thiol-reactive chemicals elicit distinct adaptive gene responses. Nuclear export is restored when disulfide bonds are reduced by thioredoxin (TRX2), whose expression is controlled by YAP1, providing a mechanism for negative autoregulation. When overexpressed, YAP1 confers pleiotropic drug-resistance and increases cellular tolerance to cadmium, iron chelators and zinc.

Belongs to the bZIP family. YAP subfamily.

72.533 kDa

MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPKKKGSKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFTFQYPLDNDNDNDNSKNVGKQLPSPNDPSHSAPMPINQTQKKLSDATDSSSATLDSLSNSNDVLNNTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFASSSILSSNSPALTNTWESHSNITDNTPANVIATDATKYENSFSGFGRLGFDMSANHYVVNDNSTGSTDSTGSTGNKNKKNNNNSDDVLPFISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSKEDIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEDDDDDKKAANMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN

YAP1

AP-1-like transcription factor YAP1

583 amino acids

Transcription activator involved in oxidative stress response and cadmium resistance (PubMed:9439570). Regulates the transcription of genes encoding antioxidant enzymes and components of the cellular thiol-reducing pathways. Activity of the transcription factor is controlled through oxidation of specific cysteine residues resulting in the alteration of its subcellular location. Activation by alkyl hydroperoxides or cadmium induces nuclear accumulation and as a result YAP1 transcriptional activity (By similarity).

Belongs to the bZIP family. YAP subfamily.

63.886 kDa

MSTSTAKRPFDNKRAGSPDDGTDSDSGGNNSGSSPASKRRERKPGRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFSAAANKAANSKDSSTAISSSNFQFEFPWKMDPSKIPSPSSDSTSPSASTSILDNANNKSVSSTNLNHSRSSISNSSSSPSNVNGLSSRKHSNTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASPVSTPSSSDLLKPKSNSNVNITNHNNNKINSKDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDNNYSTTTNNTNSPAKADGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFPDYDDPLLDILKEEQENEQVEGDSDPIQALINEEPSMPLCHDPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHMQ

YAP1

Transcriptional coactivator YAP1

504 amino acids

Isoform 2: Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).

Belongs to the YAP1 family.

54.462 kDa

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Yap1

Transcriptional coactivator YAP1

488 amino acids

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction.

Belongs to the YAP1 family.

52.383 kDa

MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTASGVVSGPAAAPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQAIRNINPSTANAPKCQELALRSQLPTLEQDGGTPNAVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL

Yap1

Transcriptional coactivator YAP1

469 amino acids

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction (By similarity). Isoform 2, isoform 3 and isoform 4 (lacking the C-terminal transactivation domain) can attenuate p73-mediated cell death signaling in transcriptional repression-induced atypical death (TRIAD) of neurons (PubMed:16461361).

Belongs to the YAP1 family.

50.501 kDa

MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAGTLTASGVVSGPAATPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPTSASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQELALRSQLPSLEQDGGTQNAVSSPGMTQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL

yap1

Transcriptional coactivator YAP1

459 amino acids

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (By similarity). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation (PubMed:25778702).

Belongs to the YAP1 family.

50.053 kDa

MDPSQHNPPVGHQIVHVRGDSETDLEALFNAVMNPKGAVVPQSVPMRMRKLPDSFFKPPEPKSHSRQASTDAGSGGVLTPHHVRAHSSPASLQLGAVSGGSLSGMASAGASPQHLRQSSYEIPDDVPLPPGWEMAKTSSGQRYFLNHIDQTTTWQDPRKALLQLNQATPPSTVPVQQQNLLSPASGPLPEGWEQAITPEGEIYYINHKNKTTSWLDPRLETRYALNQQRITQSAPVKQGGPLPPNPHGGVMGGNNQMRLQQMEKERIRLKQQELLRQSQRPQIDLQPSTANQDAEHCDELALRNQLPTSMDQDGSSNPVSSPMAQDARTMTANSNDPFLNSVSSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDPLAPSMATQPSRFPDYLDTIPGTDVDLGTLEGESMAVEGEELMPSLQEALSSDILNDMESVLAATKIDKESFLTWL

YAP1

Transcriptional coactivator YAP1

448 amino acids

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (By similarity). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation (By similarity).

Belongs to the YAP1 family.

47.822 kDa

MDPGQPQPQQPPQAAQPPAPQQAAPQPPGAGSGAPGGAAQPPGAGPPPAGHQIVHVRGDSETDLEALFNAVMNPKGANVPHTLPMRLRKLPDSFFKPPEPKAHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPSGVVTGPGAPSSQHLRQSSFEIPDDVPLPPGWEMAKTPSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNLMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSSSNQQQQMRLQQLQMEKERLRLKHQELLRQELALRSQLPTMEQDGGSQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDSISQSNIPSHQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKPDKESFLTWL

yap1

Transcriptional coactivator YAP1

442 amino acids

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (By similarity). Required for expansion of the neural plate and neural plate border zone progenitor pools. Acts as a direct regulator of pax3 expression via interaction with tead1 (PubMed:21687713). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation (PubMed:25778702).

Belongs to the YAP1 family.

48.362 kDa

MDPNQHNPPAGHQIVHVRGDSETDLEALFNAVMNPKNTIVPPSVPMRLRKLPDSFFTPPEPKSHSRQASTDAGTAGTVTPHHVRAHSSPASLQLGAVSPGALTSMGPANAPPQHLRQSSYEIPDDMPLPPGWEMAKTPSGQRYFLNHNDQTTTWQDPRKALLQMNQAAPASPVPVQQQNIMNPASGPLPDGWEQAITSEGEIYYINHKNKTTSWLDPRLDPRFAMNQQRISQSAPVKQGSQLPSSPQSGVMSGNNPIRLQQIHIEKERLRIKQELLRQRPQELALRNQLPTSMEQDGGTQNPVSSPGMGQDARNMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMETGDTLGPGSMATQPSRFPDYLDAIPGTDVDLGTLEGESMAVEGEELMPSLQEALSSDILNDMESVLAATKIDKENFLTWL