WNT-7B

Protein Wnt-7b

123 amino acids

Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). Required for normal fusion of the chorion and the allantois during placenta development (By similarity). Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (By similarity).

Belongs to the Wnt family.

14.153 kDa

single

SGSCTTKTCWTTLPKFREIGYILKEKYSEAVHVEAVRATRLRQPTFLKIKKPRTYRKPMVTDLVYIERSPNYCEEDSSTGSVGTQGRLCNRTSHHGDGCDLMCCGRGYNTHQYTKVWQCNCKF

WNT-7B

Protein Wnt-7b

123 amino acids

Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). Required for normal fusion of the chorion and the allantois during placenta development (By similarity). Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (By similarity).

Belongs to the Wnt family.

14.031 kDa

single

SGSCTTKTCWTTLPKFREIGYILKEKYNAAVQVEVVRASRLRQPTFLKIKQIRSYQKPMETDLVYIDKSPNYCEEDASTGSVGTQGRLCNRTSLSADGCDMMCCGRGYNTHQYTKVWQCNCKF