WIH1

Cysteine-rich and transmembrane domain-containing protein WIH1

82 amino acids

Required for the promotion of megasporogenesis, or promotion of germ cell formation from somatic precursor cells. Acts redundantly with WIH2. Functions in a genetic pathway downstream of SPL/NZZ and WUS and together with TRN2 in promoting megasporogenesis.

Belongs to the CYSTM1 family.

8.711 kDa

MYHQEQHPVGAPPPQGYPPKDGYPPAGYPPAGYPPPGYAQGYPAQGYPPPQYSQAPQQKQNAGMLEGCLAALCCCCLLDACF