About Services Proteins Contact

WD_1110

Gene
WD_1110
Protein
Putative 3-methyladenine DNA glycosylase
Organism
Wolbachia pipientis wMel
Length
180 amino acids
Similarity
Belongs to the DNA glycosylase MPG family.
Mass
20.313 kDa
Sequence
MMSNTILPRNFYERPTLVVAGELLGKMLKFSNFSGIITEVEAYIGMSDPACHAAKGYTNRTSVMFGMPGFSYVYFIYGMYYCLNIVTEAEGFPAAVLIRGLKLIEPLEANLGGPGILCKRLNITKEHNKQDLTISHEFCVYESHLKPDYVCTPRIGISKGQEKFWRFKNLRSCVDYLPIG