VP35

Polymerase cofactor VP35

340 amino acids

Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling. Acts as a polymerase cofactor in the RNA polymerase transcription and replication complexes. Serves as nucleoprotein/NP monomer chaperone prior to the formation of the large oligomeric RNA-bound complexes. Prevents establishment of cellular antiviral state, thereby suppressing host DC maturation. Acts by inhibiting host DDX58/RIG-I activation both by shielding dsRNA from detection and by preventing PRKRA binding to DDX58. Blocks virus-induced phosphorylation and activation of interferon regulatory factor 3/IRF3, a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition of host IKBKE and TBK1, producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the host interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR.

Belongs to the filoviridae polymerase cofactor VP35 family.

37.363 kDa

MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQQTKPNPKTRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLTEENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI

VP35

Polymerase cofactor VP35

340 amino acids

Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling. Acts as a polymerase cofactor in the RNA polymerase transcription and replication complexes. Serves as nucleoprotein/NP monomer chaperone prior to the formation of the large oligomeric RNA-bound complexes. Prevents establishment of cellular antiviral state, thereby suppressing host DC maturation (PubMed:26962215). Acts by inhibiting host DDX58/RIG-I activation both by shielding dsRNA from detection and by preventing PRKRA binding to DDX58 (PubMed:23870315). Blocks virus-induced phosphorylation and activation of interferon regulatory factor 3/IRF3, a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition of host IKBKE and TBK1, producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the host interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR (PubMed:17065211).

Belongs to the filoviridae polymerase cofactor VP35 family.

37.362 kDa

MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQQTKPNPKTRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLNSTTSLTEENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI

VP35

Polymerase cofactor VP35

329 amino acids

Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling.

Belongs to the filoviridae polymerase cofactor VP35 family.

36.15 kDa

MWDSSYMQQVSEGLMTGKVPIDQVFGANPSEKLHKRRKPKGTVGLQCSPCLMSKATSTDDIVWDQLIVKKTLADLLIPINRQISDIQSTLNEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNETTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI

VP35

Polymerase cofactor VP35

329 amino acids

Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling.

Belongs to the filoviridae polymerase cofactor VP35 family.

36.243 kDa

MWDSSYMQQVSEGLMTGKVPIDQVFGTNPLEKLYKRRKPKGTVGLQCSPCLISKSTSTDDIVWDQLIVKKTLADLLIPINRQMSDIQSTLSEMTTKVHEIERQLHDITPVVKMGKTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQAYSQKTMVKNQTTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGAVPPVIKVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI

VP35

Polymerase cofactor VP35

329 amino acids

Acts as a polymerase cofactor in the RNA polymerase transcription and replication complex. Prevents establishment of cellular antiviral state by blocking virus-induced phosphorylation and activation of interferon regulatory factor 3 (IRF3), a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition host IKBKE and TBK1 producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR (By similarity).

Belongs to the filoviridae polymerase cofactor VP35 family.

36.386 kDa

MYNDKLKICSGPETTGWISEQLMTGKIPVTDIFIDIDNKPDQMEVRLKPSSRSSTRTCTSSSQTEVNYVPLLKKVEDTLTMLVSATSRQNAAIEALENRLSTLESSLKPIQDMGKVISSLNRSCAEMVAKYDLLVMTTGRATSTAAAVDAYWKEHKQPPPGPALYEENALKGKIDDPNSYVPDAVQEAYKNLDSTSTLTEENFGKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPTIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI

VP35

Polymerase cofactor VP35

329 amino acids

Acts as a polymerase cofactor in the RNA polymerase transcription and replication complex. Prevents establishment of cellular antiviral state by blocking virus-induced phosphorylation and activation of interferon regulatory factor 3 (IRF3), a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition host IKBKE and TBK1 producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR (By similarity).

Belongs to the filoviridae polymerase cofactor VP35 family.

36.41 kDa

MYNNKLKVCSGPETTGWISEQLMTGKIPVTDIFIDIDNKPDQMEVRLKPSSRSSTRTCTSSSQTEVNYVPLLKKVEDTLTMLVNATSRQNAAIEALENRLSTLESSLKPIQDMGKVISSLNRSCAEMVAKYDLLVMTTGRATSTAAAVDAYWKEHKQPPPGPALYEENALKGKIDDPNSYVPDAVQEAYKNLDSTSTLTEENFGKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI

VP35

Polymerase cofactor VP35

329 amino acids

Acts as a polymerase cofactor in the RNA polymerase transcription and replication complex. Prevents establishment of cellular antiviral state by blocking virus-induced phosphorylation and activation of interferon regulatory factor 3 (IRF3), a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition host IKBKE and TBK1 producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR (By similarity).

Belongs to the filoviridae polymerase cofactor VP35 family.

36.116 kDa

MQQDRTYRHHGPEVSGWFSEQLMTGKIPLTEVFVDVENKPSPAPITIISKNPKTTRKSDKQVQTDDASSLLTEEVKAAINSVISAVRRQTNAIESLEGRVTTLEASLKPVQDMAKTISSLNRSCAEMVAKYDLLVMTTGRATATAAATEAYWNEHGQAPPGPSLYEDDAIKAKLKDPNGKVPESVKQAYINLDSTSALNEENFGRPYISAKDLKEIIYDHLPGFGTAFHQLVQVICKIGKDNNILDIIHAEFQASLAEGDSPQCALIQITKRIPAFQDASPPIVHIKSRGDIPKACQKSLRPVPPSPKIDRGWVCIFQFQDGKALGLKI

VP35

Polymerase cofactor VP35

329 amino acids

Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling.

Belongs to the filoviridae polymerase cofactor VP35 family.

36.145 kDa

MWDSSYMQQVSEGLMTGKVPIDQVFGTNPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLVVRKTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTTVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI

VP35

Polymerase cofactor VP35

329 amino acids

Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling.

Belongs to the filoviridae polymerase cofactor VP35 family.

36.143 kDa

MWDSSYMQQVSEGLMTGKVPIDQVFGANPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPSQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI

VP35

Polymerase cofactor VP35

329 amino acids

Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling.

Belongs to the filoviridae polymerase cofactor VP35 family.

36.131 kDa

MWDSSYMQQVSEGLMTGKVPIDQVFGANPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLIVKKTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPCQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI