VATE

V-type proton ATPase subunit E

237 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase E subunit family.

27.169 kDa

MSDADVSKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYEKKEKQVEIRKKIEYSMQLNASRIKVLQAQDDVVNAMKESASKDFLNVSHDHHVYKRLLKDLIVQSLVRLKEPGVLLRCRKEDLHLVESVLDSAKEEYASKVNVHPPEIIVDDVHLPPGPSHHHGFFHHHAEAHGPFCSGGVVIASRDGKIVFENTLDARLDVAFNKKLPEIRKWLFGQVAA

vatE

V-type proton ATPase subunit E

233 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase E subunit family.

26.572 kDa

MDDTQVNAQLDQMKNFILQEAQDKANEIKTKATQEFTSEKGRIFQNEKIKIIKEYEKKQKLIEVQKKINLSNELNKSRLSVLKVREECLRDVIKEAQKKLATISDDKDKYQTILKNLIYQGFVKLNENKIQVVGRKEDAGLLEKATTEAAAQYKKNVGKSIDVSVDKERFLPQGPKSDYNGPTCCGGVILSALEGRIICKNTLDSRLEICFDQLTPVIRTQLYGASTSRKFFD

VATE

V-type proton ATPase subunit E

230 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase E subunit family.

26.343 kDa

MNDADVSKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKDLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLPPGPGHHNAHGPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA

VATE

V-type proton ATPase subunit E

230 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase E subunit family.

26.285 kDa

MNDADVSKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDDLVSNMMEAASKEVLNVSRDHNSYKKLLKGLIVQSLLRLKEPAVLLRCRKDDHHLVESVLESAKEEYAQKLQVHPPEIIVDHHIYLPPGPGHHNAHGPSCSGGVVVASRDGKIVCENTLDARLDVVFRKKLPEIRKQLVSQVAA

VATE

V-type proton ATPase subunit E

229 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase E subunit family.

26.4 kDa

MNDTDVQKQIQQMVRFIRQEAEEKANEISVAAEEEFNIEKLQLVEAEKKKIRPEYERKEKQVQVRRKIEYSMQLNASRIKVLQAQDDLVNSMKEEAAKELLRVSGDHHHYKRLLKELVVQSLLRLREPGVLLRCREDDVHLVEHVLNSAKEEYAEKAEVHTPEIIVDSIHLPAGPSHHKEHGLHCSGGVVLASRDGKIVFENTLDARLEVAFRKKLPQIRKQLFAVAAA

VATE

V-type proton ATPase subunit E

226 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase E subunit family.

26.163 kDa

MNDTDVQNQIQQMVRFMRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKAKQVDVRRKIEYSMQLNASRIKVLQAQDDLVNAMKEAASKELLLVSGDHHQYRNLLKELIVQSLLRLKEPAVLLRCREEDKHHVHRVLHSAREEYGEKACVSHPEVIVDDIHLPPAPTSYDSHELSCSGGVVMASRDGKIVFENTLDARLEVAFRKKLPQIRKQLFAV