UL41

Virion host shutoff protein

492 amino acids

Minor structural protein that acts as an endoribonuclease during lytic infection. Degrades host mRNAs in the cytoplasm by cutting them at preferred sites, including some in regions of translation initiation. Together with inhibition of host splicing by ICP27, contributes to an overall decrease in host protein synthesis. Also, after the onset of viral transcription, accelerates the turnover of viral mRNA, thereby facilitating the sequential expression of different classes of viral genes. Binds translation initiation factors eIF4H, eIF4AI, and eIF4AII, thereby may interact directly with the translation initiation complex and thus digest specifically mRNAs. Also impedes antigen presentation by major histocompatibility complex class I and class II molecules, inhibits secretion of cytokines that would otherwise recruit lymphocytes and neutrophils cells to the site of infection and blocks the activation of dendritic cells. Impedes the alpha/beta interferon-mediated response to infection (By similarity).

Belongs to the herpesviridae VHS protein family.

55.343 kDa

MGLFGMMKFAQTHHLVKRRGLRAPEGYFTPIAVDLWNVMYTLVVKYQRRYPSYDREAITLHCLCSMLRVFTQKSLFPIFVTDRGVECTEPVVFGAKAILARTTAQCRTDEEASDVDASPPPSPITDSRPSFAFSNMRRRGHAFAPGDRGTRAAGPGPAAPWGAPSKPALRLAHLFCIRVLRALGYAYINSGQLEADDACANLYHTNTVAYVHTTDTDLLLMGCDIVLDISTGYIPTIHCRDLLQYFKMSYPQFLALFVRCHTDLHPNNTYASVEDVLRECHWTAPSRSQARRAARRERANSRSLESMPTLTAAPVGLETRISWTEILAQQIAGEDDYEEDPPLQPPDVAGGPRDGARSSSSEILTPPELVQVPNAQRVAEHRGYVAGRRRHVIHDAPEALDWLPDPMTIAELVEHRYVKYVISLISPKERGPWTLLKRLPIYQDLRDEDLARSIVTRHITAPDIADRFLAQLWAHAPPPAFYKDVLAKFWDE

UL41

Virion host shutoff protein

492 amino acids

Minor structural protein that acts as an endoribonuclease during lytic infection. Degrades host mRNAs in the cytoplasm by cutting them at preferred sites, including some in regions of translation initiation. Together with inhibition of host splicing by ICP27, contributes to an overall decrease in host protein synthesis. Also, after the onset of viral transcription, accelerates the turnover of viral mRNA, thereby facilitating the sequential expression of different classes of viral genes. Binds translation initiation factors eIF4H, eIF4AI, and eIF4AII, thereby may interact directly with the translation initiation complex and thus digest specifically mRNAs. Also impedes antigen presentation by major histocompatibility complex class I and class II molecules, inhibits secretion of cytokines that would otherwise recruit lymphocytes and neutrophils cells to the site of infection and blocks the activation of dendritic cells. Impedes the alpha/beta interferon-mediated response to infection (By similarity).

Belongs to the herpesviridae VHS protein family.

55.244 kDa

MGLFGMMKFAQTHHLVKRRGLRAPEGYFTPIAVDLWNVMYTLVVKYQRRYPSYDREAITLHCLCSMLRVFTQKSLFPIFVTDRGVECTEPVVFGAKAILARTTAQCRTDEEASDVDASPPPSPITDSRPSFAFSNMRRRGHAFAPGDRGTRAAGPGPAAPSGAPSKPALRLAHLFCIRVLRALGYAYINSGQLEADDACANLYHTNTVAYVHTTDTDLLLMGCDIVLDISTGYIPTIHCRDLLQYFKMSYPQFLALFVRCHTDLHPNNTYASVEDVLRECHWTAPSRSQARRAARRERANSRSLESMPTLTAAPVGLETRISWTEILAQQIAGEDDYEEDPPLQPPDVAGGPRDGARSSSSEILTPPELVQVPNAQRVAEHRGYVAGRRRHVIHDAPEALDWLPDPMTIAELVEHRYVKYVISLISPKERGPWTLLKRLPIYQDLRDEDLARSIVTRHITAPDIADRFLAQLWAHAPPPAFYKDVLAKFWDE

UL41

Virion host shutoff protein

492 amino acids

Minor structural protein that acts as an endoribonuclease during lytic infection. Degrades host mRNAs in the cytoplasm by cutting them at preferred sites, including some in regions of translation initiation. Together with inhibition of host splicing by ICP27, contributes to an overall decrease in host protein synthesis. Also, after the onset of viral transcription, accelerates the turnover of viral mRNA, thereby facilitating the sequential expression of different classes of viral genes. Binds translation initiation factors eIF4H, eIF4AI, and eIF4AII, thereby may interact directly with the translation initiation complex and thus digest specifically mRNAs. Also impedes antigen presentation by major histocompatibility complex class I and class II molecules, inhibits secretion of cytokines that would otherwise recruit lymphocytes and neutrophils cells to the site of infection and blocks the activation of dendritic cells. Impedes the alpha/beta interferon-mediated response to infection (By similarity).

Belongs to the herpesviridae VHS protein family.

55.244 kDa

MGLFGMMKFAQTHHLVKRRGLRAPEGYFTPIAVDLWNVMYTLVVKYQRRYPSYDREAITLHCLCSMLRVFTQKSLFPIFVTDRGVECTEPVVFGAKAILARTTAQCRTDEEASDVDASPPPSPITDSRPSFAFSNMRRRGHAFAPGDRGTRAAGPGPAAPSGAPSKPALRLAHLFCIRVLRALGYAYINSGQLEADDACANLYHTNTVAYVHTTDTDLLLMGCDIVLDISTGYIPTIHCRDLLQYFKMSYPQFLALFVRCHTDLHPNNTYASVEDVLRECHWTAPSRSQARRAARRERANSRSLESMPTLTAAPVGLETRISWTEILAQQIAGEDDYEEDPPLQPPDVAGGPRDGARSSSSEILTPPELVQVPNAQRVAEHRGYVAGRRRHVIHDAPEALDWLPDPMTIAELVEHRYVKYVISLISPKERGPWTLLKRLPIYQDLRDEDLARSIVTRHITAPDIADRFLAQLWAHAPPPAFYKDVLAKFWDE

UL41

Virion host shutoff protein

489 amino acids

Minor structural protein that acts as an endoribonuclease during lytic infection. Degrades host mRNAs in the cytoplasm by cutting them at preferred sites, including some in regions of translation initiation. Together with inhibition of host splicing by ICP27, contributes to an overall decrease in host protein synthesis. Also, after the onset of viral transcription, accelerates the turnover of viral mRNA, thereby facilitating the sequential expression of different classes of viral genes. Binds translation initiation factors eIF4H, eIF4AI, and eIF4AII, thereby may interact directly with the translation initiation complex and thus digest specifically mRNAs. Also impedes antigen presentation by major histocompatibility complex class I and class II molecules, inhibits secretion of cytokines that would otherwise recruit lymphocytes and neutrophils cells to the site of infection and blocks the activation of dendritic cells. Plays a role in the inhibition of interferon-beta activation by the cGAS/STING pathway. Mechanistically, downregulates the expression of host cGAS/MB21D1. Decreases also the accumulation of other interferon-induced mRNAs such as host IFIT3 or CH25H to subvert their antiviral activity.

Belongs to the herpesviridae VHS protein family.

54.918 kDa

MGLFGMMKFAHTHHLVKRRGLGAPAGYFTPIAVDLWNVMYTLVVKYQRRYPSYDREAITLHCLCRLLKVFTQKSLFPIFVTDRGVNCMEPVVFGAKAILARTTAQCRTDEEASDVDASPPPSPITDSRPSSAFSNMRRRGTSLASGTRGTAGSGAALPSAAPSKPALRLAHLFCIRVLRALGYAYINSGQLEADDACANLYHTNTVAYVYTTDTDLLLMGCDIVLDISACYIPTINCRDILKYFKMSYPQFLALFVRCHTDLHPNNTYASVEDVLRECHWTPPSRSQTRRAIRREHTSSRSTETRPPLPPAAGGTETRVSWTEILTQQIAGGYEDDEDLPLDPRDVTGGHPGPRSSSSEILTPPELVQVPNAQLLEEHRSYVANPRRHVIHDAPESLDWLPDPMTITELVEHRYIKYVISLIGPKERGPWTLLKRLPIYQDIRDENLARSIVTRHITAPDIADRFLEQLRTQAPPPAFYKDVLAKFWDE

UL41

Virion host shutoff protein

489 amino acids

Minor structural protein that acts as an endoribonuclease during lytic infection. Degrades host mRNAs in the cytoplasm by cutting them at preferred sites, including some in regions of translation initiation. Together with inhibition of host splicing by ICP27, contributes to an overall decrease in host protein synthesis. Also, after the onset of viral transcription, accelerates the turnover of viral mRNA, thereby facilitating the sequential expression of different classes of viral genes. Binds translation initiation factors eIF4H, eIF4AI, and eIF4AII, thereby may interact directly with the translation initiation complex and thus digest specifically mRNAs. Also impedes antigen presentation by major histocompatibility complex class I and class II molecules, inhibits secretion of cytokines that would otherwise recruit lymphocytes and neutrophils cells to the site of infection and blocks the activation of dendritic cells. Impedes the alpha/beta interferon-mediated response to infection by evading the cGAS/ STING-mediated DNA-sensing pathway and degrading CGAS via its RNase activity.

Belongs to the herpesviridae VHS protein family.

54.952 kDa

MGLFGMMKFAHTHHLVKRQGLGAPAGYFTPIAVDLWNVMYTLVVKYQRRYPSYDREAITLHCLCRLLKVFTQKSLFPIFVTDRGVNCMEPVVFGAKAILARTTAQCRTDEEASDVDASPPPSPITDSRPSSAFSNMRRRGTSLASGTRGTAGSGAALPSAAPSKPALRLAHLFCIRVLRALGYAYINSGQLEADDACANLYHTNTVAYVYTTDTDLLLMGCDIVLDISACYIPTINCRDILKYFKMSYPQFLALFVRCHTDLHPNNTYASVEDVLRECHWTPPSRSQTRRAIRREHTSSRSTETRPPLPPAAGGTEMRVSWTEILTQQIAGGYEDDEDLPLDPRDVTGGHPGPRSSSSEILTPPELVQVPNAQLLEEHRSYVASRRRHVIHDAPESLDWLPDPMTITELVEHRYIKYVISLIGPKERGPWTLLKRLPIYQDIRDENLARSIVTRHITAPDIADRFLEQLRTQAPPPAFYKDVLAKFWDE

UL41

Virion host shutoff protein

440 amino acids

Minor structural protein that acts as an endoribonuclease during lytic infection. Degrades host mRNAs in the cytoplasm by cutting them at preferred sites, including some in regions of translation initiation (By similarity).

Belongs to the herpesviridae VHS protein family.

49.502 kDa

MGILGMRRFIREHELSVHLSIQMERGLYIPIAVDTWNVLTPIMRRLDPGNMMDPVERTLRGIMQVFSLLNKKSCFPIFVLDGGRKRAFKGPVKHDYHNIDHRAPTDGDDLEASANENQPHSLAGNAPRLASGARGAHQSSRRKTALRATPHYKLCWDLITASGFPTVYVKGMEADYGCANLFHTKTVMYVWSSDSDMVFMGCDVITDLTPAFPVAVFSKHVLEYLNMTQREFANTFVDCHTNLHSPETIYSFAAKLLEHRCGSAIDEPPAASEESSASDQQSADEDEHGAWSRYTRRPPRRADAAAWGAGPGGNGQLKGVSVLCGFPSDARPFDCAPARRRRLPQRREEPAARLKKNREFLAYMNSFIGCKVINNRHTLIKRVPIRQETFDPVEIYRILHEYAPTMANKWCAEMLVKCKLKPVPPLRDVAYGKATQINLC

UL41

Uncharacterized protein UL41

141 amino acids

16.784 kDa

MYHHCCYGIITTLRPGLWCVLFFVHARHDTLLPHRQQHRRLRRHERLHRHDRRGLFRFRGLYSHLLLHVESFLRAAKDLPPPGYRVGRRGDHGLGKAPDGVGYRLLKEAIKIWEFPCLRLHDGRLFLRLGLCLVVIRARTF