Function
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Considered as a meristem identity factor required for normal growth of the young floral meristem. Acts together with LEAFY to positively regulate the B class floral homeotic genes APETALA3 and PISTILLATA. In this way, operates as a region-specific regulator for petal and stamen development. Alternatively, may play a role as a negative regulator of the C class floral homeotic genes. Interacts together with the SKP1-like protein ASK1 to form a ubiquitin E3 ligase complex and could indirectly promote the ubiquitination and degradation of specific proteins controlling the floral primordia development like repressors of B class floral homeotic genes.
Sequence
MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDGRIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFLFFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGLVSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDNATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWVPPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC