About Services Proteins Contact

Tcl1b1

Gene
Tcl1b1
Protein
Protein TCL1B1
Organism
Mus musculus
Length
116 amino acids
Similarity
Belongs to the TCL1 family.
Mass
13.432 kDa
Sequence
MAAAAFDPLGPLPVYLVSVRLGIYEDEHHRVWIVANVETSHSSHGNRRRTHVTVHLWKLIPQQVIPFNPLNYDFLPTTWKLESRNIYWATDGTHWRLLDHSQLGDTEQLILMLVLG