About Services Proteins Contact

TTHA0372

Gene
TTHA0372
Protein
UPF0102 protein TTHA0372
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Length
112 amino acids
Similarity
Belongs to the UPF0102 family.
Mass
12.884 kDa
Sequence
MGALRGRWAEEEALRFLLGKGYRLLWRNRRTPFGEVDLFMEKDGVYVVVEVKQRASARFGAPLEAITPGKVRRLLQSARFLLGRDDLPVRLEAVLVHGTPKDFRLEHLVLEL