About Services Proteins Contact

TPS09

Gene
TPS09
Protein
Terpenoid synthase 9
Organism
Arabidopsis thaliana
Length
607 amino acids
Function
Involved in terpene biosynthesis in roots. Possesses diterpene (C20) synthase activity in vitro. Does not seem to be involved in sesquiterpene (C15) biosynthesis.
Similarity
Belongs to the terpene synthase family. Tpsa subfamily.
Mass
70.437 kDa
Sequence
MEATSVFRPKLGSQFSLPSTTNLFPLRKLYGFPLTSFPGKPIKRIRLKATNTLTFDDKERTRKFKKLPLSEWTHYFHSIPLDISEMDALKEEIDELKPKVKNTFMSSQGSDSTKTKILMIYLFVSLGLAYHFEEEIYETLKEGFENIEKIMAGEEDLYTVSIIFWVFRRYGHYISSDVFQRFKGSNGSFKESLIGDAKGMLSLYEAAHLATTKDYILDEALIFTSSHLETLVATGTCPPHLLARIRNALSICQHWNFEVLVPLDFIPFYEQEKDHDEMLLKFAKLSFKYLKLIYLQDLKILTKWYKKLDFPSKFPPYFKDRCVENYFFVLPVFFEPQLSSARMLLTKGFILLGIQDDTFDRYASISEAESLGNSLKRWAPDHSMDKQPEYLKSVLKVILDTFQEFEKELSPEGRSYSVKYTIEEFQASSKANVELAKWAQVSHVPSFEKYMEVGQMEITACVTVAYILMSMGKTGTKEAFEWLKSRPKLVQSLCTKGRLMNDIAGFEDDMSRGYVVNAVNCYMKQYGVTEKEAFKELRKMVVNTHKTLNEEFLTTTCVSHYVLRETMDFARMIIVTYNGYEGFTRPDEGKIEEYMTSLFVDHTLKML