About Services Proteins Contact

TP53I13

Gene
TP53I13
Protein
Tumor protein p53-inducible protein 13
Organism
Homo sapiens
Length
393 amino acids
Function
May act as a tumor suppressor. Inhibits tumor cell growth, when overexpressed.
Mass
42.238 kDa
Sequence
MAPPPPSPQLLLLAALARLLGPSEVMAGPAEEAGAHCPESLWPLPPQVSPRVTYTRVSPGQAEDVTFLYHPCAHPWLKLQLALLAYACMANPSLTPDFSLTQDRPLVLTAWGLALEMAWVEPAWAAHWLMRRRRRKQRKKKAWIYCESLSGPAPSEPTPGRGRLCRRGCVQALALAFALRSWRPPGTEVTSQGPRQPSSSGAKRRRLRAALGPQPTRSALRFPSASPGSLKAKQSMAGIPGRESNAPSVPTVSLLPGAPGGNASSRTEAQVPNGQGSPGGCVCSSQASPAPRAAAPPRAARGPTPRTEEAAWAAMALTFLLVLLTLATLCTRLHRNFRRGESIYWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESSE

Gene
Tp53i13
Protein
Tumor protein p53-inducible protein 13
Organism
Rattus norvegicus
Length
388 amino acids
Function
May act as a tumor suppressor. Inhibits tumor cell growth, when overexpressed (By similarity).
Mass
42.71 kDa
Sequence
MVPPPPPPSRLLLVALVGLLSLHEVVAEPAEEAGTRCPEGLWPLPPQVLPRVTYTQVRQGQAEGITFFYHPCAHLWLKLQLAVLAHLCVAKPTLIPDFSLPWDRPLVLTAWGTALEMAWIEPAWAAQWLKRQWRRRRRKQRKSVWFLSDNLFGPTPMMPAPRRGKLCGRRCVQAPTLAFALRSWRPPGVEVTSRGPRRSSLSVVKKRGLRAALGLQSTPSGLRVSLASSQSLKAQQRTLGNSSVAPVSLMTGVTEGNGRFRTEAQMPSGQGNPGGCACPGQVSPAPRAAVPPRVARGPTPRTEEAAWAAMALTFLLVLLTLATLCTRLHRNFRRSESIYWGPTSDSQDTVAAILKRRLPLPSRRIKRSRRRPLLPPTPDSGPDSESSD

Gene
Tp53i13
Protein
Tumor protein p53-inducible protein 13
Organism
Mus musculus
Length
385 amino acids
Function
May act as a tumor suppressor. Inhibits tumor cell growth, when overexpressed (By similarity).
Mass
41.766 kDa
Sequence
MVHPPPPPPRLLLVALVGLLSLREVVAEPAEEAGTPCPEGLWPVPPQVLPRVTYTQVSQGQAEGIAFFYHPCAHPWLKLQLALLAHLYVAKPTLIPDFSLTWDRPLVLTAWGTALELAWIEPAWVAHWLKRQRRRKQRKSVWFLSDNLFGPTPTMPASRRGKLCGRRCVQAPTLAFALRSWRPPGAQVTSRGSGRSSISVVKRRGLRAALGLQSTPPGLRVSLASSQSLKAQQLTLGTSSVAPVSLTTGGPGGNGRSRTEAQMPSGQGNHGGCACPGQVSPAPRAAGPPRVARGPTPRTEEAAWAAMALTFLLVLLTLATLCTRLHRNFRRSESIYWGPTADSQDTVAALLKRRLPLPSRRIKRSRRRPLLPPTPDSGPDSESSD