TOMM34

Mitochondrial import receptor subunit TOM34

309 amino acids

Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state.

Belongs to the Tom34 family.

34.559 kDa

MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH

Tomm34

Mitochondrial import receptor subunit TOM34

309 amino acids

Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state (By similarity).

Belongs to the Tom34 family.

34.278 kDa

MAPKVSDSVEQLRAAGNQNFRNGQYGEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDCIKDCTSALALVPFSIKPLLRRASAYEALEKYALAYVDYKTVLQIDNSVASALEGINRITRALMDSLGPEWRLKLPPIPVVPVSAQKRWNSLPSDNHKETAKTKSKEATATKSRVPSAGDVERAKALKEEGNDLVKKGNHKKAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSLSDISSLLQIEPRNGPAQKLRQEVNQNMN

TOMM34

Mitochondrial import receptor subunit TOM34

309 amino acids

Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state (By similarity).

Belongs to the Tom34 family.

34.534 kDa

MAPKFPDCVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDSVTSALEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKAKVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH

Tomm34

Mitochondrial import receptor subunit TOM34

309 amino acids

Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state (By similarity).

Belongs to the Tom34 family.

34.461 kDa

MAPKVSDSVEQLRAAGNQNFRNGQYGEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDCIKDCTSALALVPFSIKPLLRRASAYEALEKYSLAYVDYKTVLQIDNSVASALEGINRITRALMDSLGPEWRLKLPPIPVVPVSAQKRWSSLPSENHKETAKSKSKETTATKNRVPSAGDVERARVLKEEGNELVKKGNHKKAIEKYSESLLFSSLESATYSNRALCHLVLKQYKEAEKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSLADISSLLQIEPRNGPAHKLRQEVNQNMN