About Services Proteins Contact

TK1248

Gene
TK1248
Protein
UPF0107 protein TK1248
Organism
Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Length
133 amino acids
Similarity
Belongs to the UPF0107 family.
Mass
13.867 kDa
Sequence
MKLKGRKIVGGKAEGEVIVSRKPLSFLGGVDPETGIVTDAESDIRGQSIAGKILVFPRGKGSTVGSYVIYALKKNNKAPKAIIVGEAETIVATGAIISDIPMVDGVDVSKLKTGMKVRVDADSGEVEILEDGE