Timp1

Metalloproteinase inhibitor 1

217 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Also stimulates steroidogenesis by Leydig and ovarian granuloma cells; procathepsin L is required for maximal activity.

Belongs to the protease inhibitor I35 (TIMP) family.

23.794 kDa

MAPFASLASGILLLLSLIASSKACSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.

Belongs to the protease inhibitor I35 (TIMP) family.

23.032 kDa

MAPFAPMASGILLLLWLTAPSRACTCVPPHPQTAFCNSDVVIRAKFVGTAEVNETALYQRYEIKMTKMFKGFSALRDAPDIRFIYTPAMESVCGYFHRSQNRSEEFLIAGQLSNGHLHITTCSFVAPWNSMSSAQRRGFTKTYAAGCEECTVFPCSSIPCKLQSDTHCLWTDQLLTGSDKGFQSRHLACLPREPGLCTWQSLRAQMA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.

Belongs to the protease inhibitor I35 (TIMP) family.

22.852 kDa

MAPFAPLASCILLLLWVTAPSRACTCAPPHPQTALCNSQIVIRAKFVGTAEVNQTDLNRRYEIKMTKMFKGFSALGNASDIRFVDTPALESVCGYLHRSQNRSEEFLVAGNLRDGHLQINTCSFVAPWSSLSTAQRRGFTKTYAAGCEGCTVFTCSSIPCKLQSDTHCLWTDHFLTGSDKGFQSRHLACLPREPGICTWQSLRPRMA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

23.046 kDa

MAPFAPLVSGILLLLWLTAPSRACTCVPPHPQTAFCSSEFVIRAKFVGTSEVNQTTLQRRYEIKMTKMFKGFSALGDAPDTWFVYTPAMESLCGYFHRSENRSEEFLIAGQLLDEKLYITTCSFVAPWNSLSSAQRQGFTKTYAAGCGECSVFPCSSIPCKLQSDTDCLWTDQLLTGSDKGFQSRYLACLPREPGLCTWQSLRPRTA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.

Belongs to the protease inhibitor I35 (TIMP) family.

23.171 kDa

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

23.247 kDa

MAPFEPLASGILLLLWLIAPSRACTCVLPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRTRMA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.

Belongs to the protease inhibitor I35 (TIMP) family.

23.213 kDa

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRTRIA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

23.099 kDa

MSPFAPLASGILLLLWLTAPSRACTCVPPHPQTAFCSSDLVIRAKFVGAPEFNQTASYKRYEIKMTKMFKGFNALGDAPDIRFIYTPAMESVCGYFHRSQNRSQEFLIAGQLWNGHLHITTCSFVAPWNSLSSAQRQGFTEIYAAGCEECTVFPCTSIPCKLQSDTHCLWTDQLLTGSDKGFQSRHLACMPREPGMCTWQSLRPRVA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

23.171 kDa

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

22.937 kDa

MAPLAALASSMLLLLWLVAPSRACTCVPPHPQTAFCNSDLVIRAKFVGAPEVNHTTLYQRYEIKTTKMFKGFDALGHATDIRFVYTPAMESVCGYSHKSQNRSEEFLIAGQLRNGLLHITTCSFVVPWNSLSFSQRSGFTKTYAAGCDMCTVFACASIPCHLESDTHCLWTDQLLLGSDKGFQSRHLACLPQEPGLCAWQSLRPRKD

TIMP1

Metalloproteinase inhibitor 1

207 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling (By similarity).

Belongs to the protease inhibitor I35 (TIMP) family.

23.058 kDa

MALFAPTVSGILLLLWLTAPSRACTCVPPHPQTAFCNSEVVIRAKFVGTAEVNETALYQRYEIKMTKMFKGFSALRDAPDIRFIYTPAMESVCGYFHRSQNRSEEFLIAGQLSNGHLHITTCSFVAPWNSMSSAQRRGFTKTYAAGCEECTVFPCSSIPCKLQSDTHCLWTDQLLTGSDKGFQSRHLACLPREPGMCTWQSLRPRGA

Timp1

Metalloproteinase inhibitor 1

205 amino acids

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14 (By similarity). Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.

Belongs to the protease inhibitor I35 (TIMP) family.

22.628 kDa

MMAPFASLASGILLLLSLIASSKACSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR