About Services Proteins Contact

TIFY10C

Gene
TIFY10C
Protein
Protein TIFY 10c
Organism
Oryza sativa subsp. indica
Length
232 amino acids
Function
Repressor of jasmonate (JA) responses. Acts as a repressor of JA-induced resistance to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae (Xoo). Regulates JA-induced accumulation of linalool at the transcriptional level of linalool synthase gene LIS. Linalool is important for resistance to bacterial blight pathogen Xoo.
Similarity
Belongs to the TIFY/JAZ family.
Mass
24.039 kDa
Sequence
MAGRATATATAAGKDRSSFAVTCSLLSQFLKEKKGGGGGLQGLGLGLRPAPAAPPAAGAGGAFRPPPTTMNLLSGLDAPAVEVEPNTADTAADELPLIKAPADQQSDESASEAAGEKAQQLTIFYGGKVVVFENFPSTKVKDLLQIVSTGDGVDKNTGTAATQSLPRPAHNSLPDLPIARRNSLHRFLEKRKGRMNANAPYQANCTAAPSKQANGDKSWLGFGQEMTIKQEI

Gene
TIFY10C
Protein
Protein TIFY 10c
Organism
Oryza sativa subsp. japonica
Length
232 amino acids
Function
Repressor of jasmonate (JA) responses. Acts as a repressor of JA-induced resistance to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae (Xoo) (PubMed:23104764). Regulates JA-induced accumulation of linalool at the transcriptional level of linalool synthase gene LIS. Linalool is important for resistance to bacterial blight pathogen Xoo (PubMed:23889289).
Similarity
Belongs to the TIFY/JAZ family.
Mass
24.053 kDa
Sequence
MAGRATATATAAGKDRSSFAVTCSLLSQFLKEKKGGGGGLQGLGLGLRPAPAAPPAAGAGGAFRPPPTTMNLLSGLDAPAVEVEPNTAETAADELPLIKAPADQQSDESASEAAGEKAQQLTIFYGGKVVVFENFPSTKVKDLLQIVSTGDGVDKNTGTAATQSLPRPAHNSLPDLPIARRNSLHRFLEKRKGRMNANAPYQANCTAAPSKQANGDKSWLGFGQEMTIKQEI