About Services Proteins Contact

TIC22

Gene
TIC22
Protein
Protein TIC 22, chloroplastic
Organism
Arabidopsis thaliana
Length
268 amino acids
Function
Involved in protein precursor import into chloroplasts. Imported into the intermembrane space via the Toc translocon. May be involved in the import pathway used by proteins without a cleavable N-terminal pre-sequence (By similarity).
Similarity
Belongs to the Tic22 family.
Mass
30.105 kDa
Sequence
MESSVKPNPFLSFSSFIHHQCTRFSSDLSARIEDTKRFAETLATRRFSLPTPPPFASVSQSKSGTPTTTLSPSLVAKALAGTSVFTVSNTNNEFVLISDPTGGKSIGLLCFRQEDAEAFLAQARLRRRELKTNAKVVPITLDQVYLLKVEGISFRFLPDPIQIKNALELKSSGNKNGFDGVPVFQSELLVVRKKNRRYCPVYFSKEDIERELSKYTRASRGDQQIMVGSLEDVLRKMEMSEKNSGWEDVIFIPPGRSYAQHMQDLIKE

Gene
TIC22
Protein
Protein TIC 22, chloroplastic
Organism
Pisum sativum
Length
252 amino acids
Function
Involved in protein precursor import into chloroplasts. Imported into the intermembrane space via the Toc translocon. May be involved in the import pathway used by proteins without a cleavable N-terminal pre-sequence.
Similarity
Belongs to the Tic22 family.
Mass
28.2 kDa
Sequence
MESQGQWNPLLSFSRFINHHSNHLATRLEETKRLAGTLIQSHTRTKPAFAATLTPNHVAKSLAGTSVYTVSNSDNEFVLMSDAEGAKSIGLLCFRQEDAEAFLAQVRSRKKEFRGGAKVVPITLDQVYMLKVEGIAFRFLPDPVQIKNALELRAANRGSFDGVPVFQSDLLVVKKKNKRYCPVYFSKEDLEYELSKVSRSSKGVGVSQHIMVGSFEDVLKKMELSEKSSGWEDLVFIPPGKKHSQHMQEVIA