About Services Proteins Contact

THUMPD1

Gene
THUMPD1
Protein
THUMP domain-containing protein 1
Organism
Bos taurus
Length
357 amino acids
Function
Functions as a tRNA-binding adapter to mediate NAT10-dependent tRNA acetylation.
Similarity
Belongs to the THUMPD1 family.
Mass
39.754 kDa
Sequence
MAARIQQSPQPGGGKRKGKAQYVQAKRARRWDGGGPRQLEPGIQGILITCNMNERKCVEEAYSLLNEYGDDMYGPEKFADKDQQPSGSEGEDDDVEAALKKEVGDIKASTEMRLRRFQSVESGANNVVFIRTLGIEPEKLVHHILQDIYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHMNREEVIKELAGIVGSLNSENKVDLSNPQYTVVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSAKDLSQLNPKQAAQTGNGKEAKLESGDKSSQNDPAEGKNNQQVVPENSEELGPTESISETHVVNEGVAKPELASQVTEGSESNENDL

Gene
THUMPD1
Protein
THUMP domain-containing protein 1
Organism
Homo sapiens
Length
353 amino acids
Function
Functions as a tRNA-binding adapter to mediate NAT10-dependent tRNA acetylation (PubMed:25653167).
Similarity
Belongs to the THUMPD1 family.
Mass
39.315 kDa
Sequence
MAAPAQQTTQPGGGKRKGKAQYVLAKRARRCDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGDDMYGPEKFTDKDQQPSGSEGEDDDAEAALKKEVGDIKASTEMRLRRFQSVESGANNVVFIRTLGIEPEKLVHHILQDMYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNREEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSPKDPSQLNSKQGNGKEAKLESADKSDQNNTAEGKNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNENDFS

Gene
Thumpd1
Protein
THUMP domain-containing protein 1
Organism
Mus musculus
Length
350 amino acids
Function
Functions as a tRNA-binding adapter to mediate NAT10-dependent tRNA acetylation.
Similarity
Belongs to the THUMPD1 family.
Mass
38.885 kDa
Sequence
MATTAQQSPQPVAGKRKGKSQFLPAKRARRGDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGDDMYGPEKFIDKDQQPSGSEGEDDDAEAALKKEVGDIKASTEKRLRRFQSVESGANNVVFIRTLGIEPEKLVHHILQDMYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHMNREEVIKELAGIVGSLNSENKVDLTNPEYTVVVEIIKAVCCLSVVKDYVLFRKYNLQEVVKSAKDSQPHPKLGNGKEAKLEPDSKLSQSDPPEGNQVAPESIEELGQTEPGSETQAGSEGDAKPEPESQVSEVPKTNENELS