Function
Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export. Contributes to the integrity of the endogenous trans-acting small interfering RNA (ta-siRNA) pathway. May process or transport a long RNA molecule so that it can be a template for secondary siRNA production. May participate in the trafficking of siRNA precursors to the ARGONAUTE catalytic center. Required for the generation of functional messenger ribonucleoproteins (mRNPs).
Sequence
MEETTIPFKSLHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKAKDLELKGHTDSVDQLCWDPKHSDLVATASGDKSVRLWDARSGKCTQQVELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRRKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLKPLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLRTFTKLEWPVRTISFNYSGEYIASASEDLFIDIANVQTGRTVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGVFRIFGFESS