thi1

Thiamine repressible genes regulatory protein thi1

775 amino acids

Transcription factor that activates the nmt1 promoter. Regulation of thiamine repressible genes. Positively regulates conjugation during meiosis.

88.06 kDa

MNEEIGFLKNQLFADVKDLERKKKRRVPPEQRRRVFRACKHCRQKKIKCNGGQPCISCKTLNIECVYAQKSQNKTLSREYLEELSERQLCLEYIFSRMCPNFNLETKNLISISKKLSENENLPVSKIAEVTNELDTLVRINDQLSRNHISGTTEEMQSSSSLIAGEVQPGISFRDQLKVGKLEDTLYLGPTTSEAFIERLQNELELESISEDDLYSKRLSPSVSYSEFDEQLLLHARSLIPSKAVVEFLINSFFINVQTNLFVYHPHFFKCRLEIFLAMENQIDAGFLCILLMVLAFGNQYTAEQQEDVSKSNFHASNIGNRLFSAALSIFPLVLLQSDVSAVQSSLLIGLYLQSTIYEKSSFAYFGLAIKFAVALGLHKNSDDPSLTQNSKELRNRLLWSVFCIDRFVSMTTGRRPSIPLECISIPYPVILPDLEIPGSQSIVENMRAVINLAKLTNEICDSLYWNPSPSFESQVNSVRRIYARLELWKSDLHSSVVFDESAVQHPLFRSNAHVQMIYDNAIMLTTRVIMVKKLKDKDLTAENRRYIQLCVESATRVINIAHLLLTHKCLSSLSFFGLHVPFASAPILLLSLHYENSQDIQAVVTKLWQVLEFLSSRCEFARESLNYLKSFNKQLSRRNAPDINNPIADFQNSFQNWQSWVGDMSHGDMLSTFKLTGESSNGSNSTPNEAFQPFDQTSSLYNVPGLNKSYVSNQPSLLTPETFLPDPVLNLEVDKQWTAPTFLSWTELLGPTNVSEQSSHTAEQTSNLTLEKNG

THI1

Thiamine thiazole synthase, chloroplastic

357 amino acids

Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance.

Belongs to the THI4 family.

36.893 kDa

MAIKMNLASSKVGAKASAKSVRGARLVARVAQPMSPSSAATAAADASMLARAGLPPTTTPYDDYKFAPIREAEVNRAMTRRYFKDMDEFAESDVVIVGAGSAGLACAFELGRIAPHLKVALMEQSVAPGGGAWLGGQLFSAMVVRKPAHEMLDALQVPYEDEGHYVVVRHAALLTSTLMSHVLKNPNVKLFNATAVEDLIVKPDPALGPGGRRVAGVVTNWSLVAQAHGTQSCMDPNVIEAGVVVSACGHDGPFGATGVKRLARLGMVPGGEVPGMGALDMEAAEGSIVNNTREVVPGMVLTGMELAEVDGSPRMGPTFGAMIVSGMRAAHMAVAALERRRALSAAAAEGAAAEAQA

THI1

Thiamine thiazole synthase, chloroplastic

356 amino acids

Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance.

Belongs to the THI4 family.

37.595 kDa

MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETADA

THI1

Thiamine thiazole synthase, chloroplastic

352 amino acids

Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance.

Belongs to the THI4 family.

37.065 kDa

MASTLTSKPQRLALFENSASSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVCYELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELILAAADSAEIADA

THI1

Thiamine thiazole synthase, chloroplastic

349 amino acids

Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance. Acts as a positive regulator for the abscisic acid-induced activation of slow type anion channels during stomatal closure by repressing CPK33 kinase activity.

Belongs to the THI4 family.

36.664 kDa

MAAIASTLSLSSTKPQRLFDSSFHGSAISAAPISIGLKPRSFSVRATTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVDA

THI1

Thiamine thiazole synthase, chloroplastic

48 amino acids

Involved in biosynthesis of the thiamine precursor thiazole. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylic acid (ADT), an adenylated thiazole intermediate. The reaction includes an iron-dependent sulfide transfer from a conserved cysteine residue of the protein to a thiazole intermediate. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme. May have additional roles in adaptation to various stress conditions and in DNA damage tolerance (By similarity).

Belongs to the THI4 family.

5.125 kDa

multiple

FQPIKESIVSRLFNAVAAEDLIVKGGREIVPGMIVTGMEVAEIDGAPR

THI1

Thionin

47 amino acids

Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known.

Belongs to the plant thionin (TC 1.C.44) family.

5.288 kDa

KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK