TGS1

Trimethylguanosine synthase

853 amino acids

Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation.

Belongs to the methyltransferase superfamily. Trimethylguanosine synthase family.

96.62 kDa

MCCEKWSRVAEMFLFIEEREDCKILCLCSRAFVEDRKLYNLGLKGYYIRDSGNNSGDQATEEEEGGYSCGTAESHDSKGIGLDESELDSEAELMRSMGLPLQFGRITAHKDFEVSMNTRNKVKIKKKKHQKKYLDEIVQESWRKEYEEDDILASDDPSSIEQYENTRTYELQSKKDTETENPPVENTLSPKLEITEKWEKYWNEYGGGLLWQSWQEKHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVDNDSSGTSDKDHSEILDGISNIKLNSEEVTQSQLDSCTSHDGHQQLSEVSSKRECPASGQSEPRNGGTNEESNSSGNTNTDPPAEDSQKSSGANTSKDRPHASGTDGDESEEDPPEHKPSKLKRSHELDIDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKYLDMRRQIKMKNKHIFFTKESEKPFFKKSKILSKVEKFLTWVNKPMDEEASQESSSHDNVHDASTSSDSEEQDMSVKKGDDLLETNNPEPEKCQSVSSAGELETENYERDSLLATVPDEQDCVTQEVPDSRQAETEAEVKKKKNKKKNKKVNGLPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPASET

Tgs1

Trimethylguanosine synthase

853 amino acids

Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation (By similarity).

Belongs to the methyltransferase superfamily. Trimethylguanosine synthase family.

96.79 kDa

MCCEKWNHVAEMLLFIEDREEEYKILCLCSRAFVEDRKLYNLGLKGYYVKSSGNNAGDQGTEEEEDGHSNGTAESHSPNESDLDSEAKLMRSMGLPIQFGRMSSHENFEMSMNARNKAKVKQKRRKHQKRYLDEMVRESWRNDYEEDDLVVSDDPSSVEHCENNRTCEIQSKAGSEVENLPVENTLAPKLEVPENWEKYWNEYGEGLLWQSWQEKYPDQTLSSEPWNLPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFTASQNCDKDVYTSHTEVDQNAESSLKADVMTFSSSPNIVEDEIPGSNDNDHNEIITAINNITVSAEKVEQSQLDSSQHCDEPLSEITGKECPASGGSDSCNGTPKENDISENRSSDQPAKELQESSGTNKGKHRPHHNGADGHESDDDPPEHKPSKVKRSHELDVDENPDSEVDDNGFLLGFKHGSGQKYGGIPNFSHRQVRYLEKNVKYKSKYLDLRKQMPVKSKHILFTEDSGKPFVVCKSKVRSKVEKFLKWVNERVDEETSQDSLSQNKMQDTCTSSDSEEQDMSLEKADNLMETRDPEPEKCQIISSATELEAEKSEVGSLVATVPENCSTEEIPNSPHAETEVEIKKKKKKNKNKKINDLPPEIASVPELAKYWAQRYRLFSRFDDGIKLDKEGWFSVTPEKIAEHIAGRVSQAFRCDVVVDAFCGVGGNTIQFALTGKRVIAIDIDPVKIDLARNNAEVYGIADKIEFICGDFLLLAPCLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSQKITNNIVYFLPRNADIDQVASLAGLGGQVEIEQNFLNNKLKTITAYFGDLIRRPALLKTSTSEAEV

Tgs1

Trimethylguanosine synthase

850 amino acids

Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation (By similarity).

Belongs to the methyltransferase superfamily. Trimethylguanosine synthase family.

96.045 kDa

MCCEKWSHVAEMLLFIEDREEEYKILCLCSRAFVEDRKLYNLGLKGYYVKSSGNNAGDRVTEEEEDDHSSGTTESHSADEGDLDPEAKLMRSMGLPVRFGRMSTHGSFEVSMNARNKAKVRQKRRKHRKQYLDEIVREDWRNDCEEDDLVVSDDPSSVEHCENNSACEIQSKTDAEAENLPVENTLAPKLEVTENWEKYWNEYGEGLLWQSWQEKYPDQTLSSEPWNLPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFVASQNCDKDVCTSHTQVDQNAESSLKADGTTLSSSPNTAEDESLGSNDNDHNEIIAGINKITLSAEEVEQSQLDSSEHCDKPLSEVTGKECPASGGSDSCHGTPKESDISENRSSDQPAQELQESSGTNTSKHRPHHNGTDGNESEDDPPDHKPSKMKRSHELDIDENPDSEVDDNGFHLGFKHGSGQKYGGIPNFSRRQVRYLEKNVKYKSKYLDMRKRMTVKNKHIVFSEESGKPFIRKSKVRSKVEKFLKWVNEPVDEEISQEPLSHNKMQDTCTSSDSEEQDMSMEKTDGLMETRDPEPENCQTISSASELEAEKSEGGSLVAAVPENCSTEGVANSPRAEAEVEIKKKKKKKKKNKNKKINGLPPEIASVPELAKYWAQRYRLFSRFDDGIKLDKEGWFSVTPEKIAEHIAGRVSQSFNCDIIVDAFCGVGGNTIQFALTGKRVIAIDIDPVKIDLARNNAEVYGVADKIEFICGDFLLLAPCLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSQKITNNIVYFLPRNADVDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPALRSAEA

tgs1

Probable diacyglycerol O-acyltransferase tgs1

463 amino acids

Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for storage lipid synthesis (By similarity).

Belongs to the long-chain O-acyltransferase family.

50.755 kDa

MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLRLRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFELIADLMARRLDRGRPLWEVWVIEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGGFRVNPSEALTASTAVMAGIVRAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLADVEQVCRKFDVTINDVALAAITESYRNVFIQRGERPRFDSLRTLVPVSTRSNSALSKTDNRVSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLLMRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAMQLRTSVAMLSYADDLYFGILADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV

tgs1

Probable diacyglycerol O-acyltransferase tgs1

463 amino acids

Upon expression in E.coli functions as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Prefers C(26:0)-CoA over C(18:1)-CoA. TG synthesis activity increases in M.tuberculosis upon oxygen depletion and NO treatment, with concomitant accumulation of TG in inclusion bodies. As disruption of the gene encoding this protein obviates TG synthesis this seems to be the major enzyme involved in production of TG. Has no wax synthase activity to produce wax esters.

Belongs to the long-chain O-acyltransferase family.

50.721 kDa

MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLRLRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFELIADLMARRLDRGRPLWEVWVIEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGGFRVNPSEALTASTAVMAGIVRAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLADVEQVCRKFDVTINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALSKTDNRVSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLLMRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAMQLRTSVAMLSYADDLYFGILADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV

TGS1

Trimethylguanosine synthase

315 amino acids

Catalyzes the two serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylates the m3G cap on TLC1 telomerase which affects telomere silencing and telomere length regulation. Required for pre-mRNA splicing, pre-rRNA processing and small ribosomal subunit synthesis. Involved in nucleolar structural organization.

Belongs to the methyltransferase superfamily. Trimethylguanosine synthase family.

36.527 kDa

MGRTFIHASKIKHAARKRKHHSNFRTLIKLLNNDAYKIESSKPLKNGKLFKYWKNRRRLFSKIDSASIYMTDELWFSVTPERIACFLANFVKACMPNAERILDVFCGGGGNTIQFAMQFPYVYGVDYSIEHIYCTAKNAQSYGVDDRIWLKRGSWKKLVSKQKLSKIKYDCVFGSPPWGGPEYLRNDVYDLEQHLKPMGITKMLKSFLKLSPNVIMFLPRNSDLNQLSRATRKVLGPFAKCKVLYVKENGYMKGIFCMWGECFFNYEPASTENSRRESSEKEELSSENEELSKRKKHESTTTTKDNTVDIYDVNG

tgs1

Trimethylguanosine synthase

239 amino acids

Catalyzes the two serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Required for pre-mRNA splicing, pre-rRNA processing and small ribosomal subunit synthesis. Involved in nucleolar structural organization.

Belongs to the methyltransferase superfamily. Trimethylguanosine synthase family.

27.157 kDa

MNKNEELDEDELLKKCIICPPVPKALKKYWNNRYNLFSRFDEGIWLDYQSWYSVTPEKVAVAIAKSVVDFIQPELIIDAFSGCGGNTIQFAKYCPVISIEIDPIKIAMAKHNLEIYGIPSSRVTFIQGDVLDTFKSLQFAKDYRSLVFMSPPWGGPSYSGKTVYSLNDLNPYAFDVLFKEATRISPYVAAFLPRNTDVKELAAYGSIHNKPYITNFLFEGYAKAICCYFNMKGAIARKI