Function
Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs) (PubMed:23942233, PubMed:26321140). With Klf2, acts as the major effector of self-renewal that mediates induction of pluripotency downstream of LIF/Stat3 and Wnt/beta-catenin signaling (PubMed:23942238, PubMed:23942233, PubMed:26321140). Required for normal duct development in the salivary gland and kidney (PubMed:17079272). Coordinates the development of the kidney collecting ducts intercalated (IC) and principal (PC) cells, which regulate acid-base and salt-water homeostasis, respectively (PubMed:28577314). Regulates the expression of IC genes including subunits B1 and D2 of the V-ATPase complex, Oxgr1, Ca12, Slc4a1, Aqp6 and IC-specific transcription factor Foxi1 (PubMed:28577314). Regulates also the expression of Jag1 and subsequent notch signaling in the collecting duct (PubMed:28577314). Jag1 initiates notch signaling in PCs but inhibits notch signaling in ICs (PubMed:28577314). Acts as a transcriptional suppressor that may suppress UBP1-mediated transcriptional activation (PubMed:11073954). Modulates the placental expression of CYP11A1 (By similarity).
Sequence
MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENGARLPPLQYVLCAATSPAVKLHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEYQQLEGWRWSRPGDRILDIDIPLSVGILDPRASPTQLNAVEFLWDPSKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNESGDYSEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVPYQANNTPSPSYNGSPNSFGLREGNSSPNHPVEPLPLGSDHLLPSASIQDAQQWLHRNRFSQFCWLFASFSGADLLKMSRDDLVQVCGPADGIRLFNAIKGRNVRPKMTIYVCQELEQNQLPLPQKQDDSGDNSLCVYHAIFLEELTTLELTEKIASLYSIPPQHIHRVYRQGPAGIHVVVSNEMVQNFQDESCFILSTLKAESNDGYHIILKCGL