About Services Proteins Contact

TBT2

Gene
TBT2
Protein
Tryptamine benzoyltransferase 2
Organism
Oryza sativa subsp. japonica
Length
448 amino acids
Function
Hydroxycinnamoyl transferase that catalyzes the transfer of an acyl from benzoyl-CoA to tryptamine, to produce benzoyl tryptamine. Serotonin and tyramine serve as acyl acceptors in vitro. Specific for benzoyl-CoA as acyl donor. Has no activity with p-coumaroyl-CoA, caffeoyl-CoA, or feruloyl-CoA as acyl donors.
Similarity
Belongs to the plant acyltransferase family.
Mass
48.023 kDa
Sequence
MEITSSAMLKPAPTPTPHPLAGEKVPLTAFDRAAFDVFVPMVFAYRAPAPSSEAVKEGLRMAVAAYPLAAGRLAVDVAADGQGRRRRRRVLHVNDEGALVLDATVEADLDAVLAANVATDLYPAPPEHSFGAAVLQVQLTRFRCSGLVVGLIVHHHVFDGHSTSAFCTTWARAVRDGEAFSVPSPCLDRAITSVPRSPPAPVFDHRSIEFKVGNKSSDSSGAAAAAVEKITNIGVRFTAKFVAELKARVGGRCSTFECVLAHAWKKMTAARGLKPEEFTRVRVAVNCRRRANPPAPADLFGNMVLWAFPRLQVRRLLSASYRDVVGAIRAAVARVDGEYIQSFVDYVEVADARGEELAATAAEPGETLCPDLEVDSWLGFRFHEMDLGTGPPAAVLSPDLPIEGLMILVPVGGDGGGVDLFVALADDRAQVFEQICYSLEEHAIPSHL