TAF13

Transcription initiation factor TFIID subunit 13

167 amino acids

Functions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription.

Belongs to the TAF13 family.

19.132 kDa

MSRKLKKTNLFNKDVSSLLYAYGDVPQPLQATVQCLDELVSGYLVDVCTNAFHTAQNSQRNKLRLEDFKFALRKDPIKLGRAEELIATNKLITEAKKQFNETDNQNSLKRYREEDEEGDEMEEDEDEQQVTDDDEEAAGRNSAKQSTDSKATKIRKQGPKNLKKTKK

TAF13

Transcription initiation factor TFIID subunit 13

126 amino acids

TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription. May be involved in polycomb repressive complex 2 (PRC2) mediated repression.

Belongs to the TAF13 family.

14.254 kDa

MSNTPAAAASSSSKSKAAGTSQPQEKRKTLFQKELQHMMYGFGDEQNPLPESVALVEDIVVEYVTDLTHKAQEIGSKRGRLLVDDFLYLIRKDLPKLNRCRELLAMQEELKQARKAFDVDEKELVD

TAF13

Transcription initiation factor TFIID subunit 13

124 amino acids

Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells (By similarity).

Belongs to the TAF13 family.

14.287 kDa

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

TAF13

Transcription initiation factor TFIID subunit 13

124 amino acids

Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells.

Belongs to the TAF13 family.

14.287 kDa

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

Taf13

Transcription initiation factor TFIID subunit 13

124 amino acids

Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells (By similarity).

Belongs to the TAF13 family.

14.287 kDa

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

TAF13

Transcription initiation factor TFIID subunit 13

124 amino acids

Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells (By similarity).

Belongs to the TAF13 family.

14.287 kDa

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

taf13

Transcription initiation factor TFIID subunit 13

111 amino acids

Functions as a component of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription (By similarity).

Belongs to the TAF13 family.

12.956 kDa

MSMENRRGRPPTRRQHLFTKDLKSLMYAFGDDVNPAPDSINVLEEIVVDYINEMCLEAARIAGNRNKVKVDDFKFALRDDPKKLGRVEELLVLQKMIADTRNVMKYNKDHF

taf13

Transcription initiation factor TFIID subunit 13

106 amino acids

TFIID beta-specific TAFII.

Belongs to the TAF13 family.

12.749 kDa

MSTKRKRMFSKELKHMMYGFGDVREPLHESIDLLEELVFEFIQEMTLKAAQVSNKRGKFQTEDLVFLVRKDPKKYYRVIELLRMNEELKKAKKAFDETNVEEEENV