About Services Proteins Contact

Segment-11

Gene
Segment-11
Protein
Non-structural protein 4
Organism
Banna virus (strain Indonesia/JKT-6423/1980)
Length
180 amino acids
Mass
20.606 kDa
Sequence
MTIQVQNLNCCPGRFVCVHKMTLLIILIISAAVTVIDQLYQKLPYDEQTKYIVSTITDGINATIISVMAILGLNNLNRVRYSKLDENGVYSQEMVTMNVQSDAANNKKQLKKKENEDVDEEKGLYPNLKLTEPTAPMIHNYMYDHKTQQAYLLTEHQIEQIKQNSVDPNNTPKIEVRSQF