About Services Proteins Contact

Sde_3189

Gene
Sde_3189
Protein
dTTP/UTP pyrophosphatase
Organism
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Length
210 amino acids
Function
Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.
Similarity
Belongs to the Maf family. YhdE subfamily.
Mass
22.769 kDa
Sequence
MTTSSHHNKGDNSADLYLASQSPRRRELLAQIGVKVAVLSVDVAEQREVGESPAQYVQRLAYDKAMAGAKLAATQPRSLPCLGSDTIVVIENRVLEKPRDEEDGVAMLLALSGQTHQVMTAVAVATEAKQLMRLSVTDVTFREISRAEAIEYWRTGEPADKAGGYGIQGLGAVFVRELKGSYTAVVGLPLFETKTLLDAFEVPVWQNLAP