Srd5a3

Polyprenol reductase

330 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT) (By similarity).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

38.164 kDa

MASWVGTELSALNPLRTLWLALAAAFLLALLLQLAPAGLLPNCALFQDLIRYGKTKLSGPRRPAVCRAFDVPKRYFSHFYVVSVLWNGFLLWFLSRSLFLGAPFPNWLRALLRTLGSTQFRALEMESKASQMLVGELALSAFLVLVFLWVHSVRRLFECFYISVFSNAVMHVVQYCFGLVYYVLVGLTVLSQVPMDDKNVYMLGKNLLLPARWFHVLGMMMFLWSSAHQYECHVILSNLRRNKKGAIVHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGFHNFTWWLVVAYVFFCQALSAFFNHKFYKSTFVSYPKHRKAFLPFLF

Srd5a3

Polyprenol reductase

330 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

37.936 kDa

MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCALFQDLLRYGKTKQSGSRRPAVCRAFDVPKRYFSHFYVISVVWNGSLLWLLSQSLFLGAPFPNWLSALLRTLGATQFQALEMESKASRMPAAELALSAFLVLVFLWVHSLRRLFECFYVSVFSNAAIHVVQYCFGLVYYVLVGLTVLSQVPMDDKNVYVLGKNLLIQARWFHILGMVMFFWSSAHQYKCHVILSNLRRNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNLTWWLVVTYVFSSQALSAFFNHKFYRSTFVSYPKHRKAFLPFLF

Srd5a3

Polyprenol reductase

330 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

38.092 kDa

MAGWAGAELSVLNPLRALWLLLAAAFLLALLLQLAPARLLPSCALFQDLIRYGKTKQSGSRRPAVCRAFDVPKRYFSHFYVVSVLWNGSLLWFLSQSLFLGAPFPSWLWALLRTLGVTQFQALGMESKASRIQGKKLALSTFLVLVFLWVHSLRRLFECFYVSVFSNTAIHVVQYCFGLVYYVLVGLTVLSQVPMNDKNVYALGKNLLLQARWFHILGMMMFFWSSAHQYKCHVILSNLRRNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNVTWWLVVTYVFFSQALSAFFNHRFYKSTFVSYPKHRKAFLPFLF

srd5a3

Polyprenol reductase

319 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT) (By similarity).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

36.591 kDa

MQLVQLLPPGVSLLALVWLAVDAAFLTALLLYLQRGCDSGRSLLCSVFQDLIRYGKTKSGLRRPSWLQWFDIPKRCFWHFYFVSLVWNGFLLWILLHLLLQSVPVPEWLQAVLQFLCAGSEPQVLGGELSVVLAFSLLWLHSLRRLLECLFVSIFSNGVIHFVQYCFGLGYYILIGFTILGYCPLDRRTAVSLDDLLMQGNWYHILGLTLYVWASLHQYTCHCILADLRKSASGAIINLKHAVPTGDWFEKVSCPHYFAELLIYLSIAVVFGLLNTIWWLVVLYVLLSQALAAVLCHEFYHEKFDSYPIHRKAFIPLIF

SRD5A3

Polyprenol reductase

318 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

36.521 kDa

MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF

SRD5A3

Polyprenol reductase

318 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT) (By similarity).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

36.775 kDa

MAPWAAAQLWALNPLRALWLTLAAAFLLTLLLQLVPPGLLPGCALFQDLIRYGKTKREGQSRPAVCRVFDVPKRYFSHFYIISALWNGFLLWHLTQSVFLGVPFPNWLHGLLRILGASQFQGGELALSAFLVLVFLWLHSLRRLFECFYVSVFSNTVIHIVQYCFGLVYYVLTGLTVLSQVPMDGRNAYVIGKNLLMQARWFHILGMLMFIWSSVHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYISMAVTFGFHNLTWWLVVTYVFFSQALSAFLSHKFYKSKFVSYPKHRKAFLPFLF

srd5a3

Polyprenol reductase

309 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT) (By similarity).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

35.708 kDa

MFHILSIVNIIWLLLALCFGAAFCLNKFSVKLPNRVEHVFQDFIRYGKTKENIKRASWQLVFDLSKRYFYHFYVVSVMWNGLLLLFSIRSVVMSEAFPDWIIDVLGSLTGRSRGAWNEIHLSTLLLQVLLWVHTLRRLLECLFVSVFSDGVINVVQYAFGLSYYIILGLTVLCTNDSLPQSESVSFFNQLTWYHVVGTLLFFWASFLQHQSLSLLAKMRTDSSGKVETLAHKMPCGGWFELVSCPHYLAELLIYAAMCVCCGCASLTWWMVVLYVLCNQALAAQLCHEYYRSKFKTYPHHRKAFIPFVL

srd5a3

Polyprenol reductase

308 amino acids

Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT) (By similarity).

Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.

35.876 kDa

MTLLALVWLLLDATFLITLLWHLLQGCKSGHSLLCSVFQDLIRYGKTKTGLQRPAWLQWFDIPKRCFWHFYCVSLIWNGCLLWILLRLLLQSVPVPEWLQLVLHFLHAGSEPQILDRELSVILALALLWLHSLRRLLECLFVSVFSNGVIHLVQYCFGLGYYFLIGITVLTYCPLDRRTVSTDNLLTQCHWYHILGLALYIWASLHQYRCHCILAGLRKSASGNVINLNHSVPCGDWFERVSCPHYFAELLIYVSIAVVFGLLNTIWWLVVLYVLLNQALAALLCHEFYHEKFDTYPIHRKAFIPFIF