SPT3

Protein SPT3

337 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA and SLIK. SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3 and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SALSA, an altered form of SAGA, may be involved in positive transcriptional regulation. SPT3 is required for recruitment of TATA-binding protein (TBP) to SAGA-dependent promoters. During SAGA-mediated transcriptional inhibition, SPT3 and SPT8 prevent binding of TBP to the TATA box. SLIK is proposed to have partly overlapping functions with SAGA. It preferentially acetylates methylated histone H3, at least after activation at the GAL1-10 locus. SPT factors 3, 7 and 8 are required for the initiation of Ty transcription from the delta promoter. SPT3 regulates Ty1 as well as the mating factor genes.

Belongs to the SPT3 family.

38.8 kDa

MMDKHKYRVEIQQMMFVSGEINDPPVETTSLIEDIVRGQVIEILLQSNKTAHLRGSRSILPEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDASAGVASGTGNPGAGGEDDLKKAGGGEKDEKDGGNMMKVKKSQIKLPWELQFMFNEHPLENNDDNDDMDEDEREANIVTLKRLKMADDRTRNMTKEEYVHWSDCRQASFTFRKNKRFKDWSGISQLTEGKPHDDVIDILGFLTFEIVCSLTETALKIKQREQVLQTQKDKSQQSSQDNTNFEFASSTLHRKKRLFDGPENVINPLKPRHIEEAWRVLQTIDMRHRALTNFKGGRLSSKPIIM

SPT3

Protein SPT3

328 amino acids

SPT factors 3, 7 and 8 are required for the initiation of Ty transcription from the delta promoter. SPT3 regulates Ty1 as well as the mating factor genes. Interacts directly with TATA-binding protein. It is likely to be required for normal TBP function at a subset of RNA polymerase II-dependent promoters.

Belongs to the SPT3 family.

37.452 kDa

MSDKYKYRVEIQQMMFVSGENNEPPVETTSLIEDIVRGQVVEILLQATRTANCRGSKSIVPEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDAQQAAAGGGAGDGSGPGGIDDDDAGKKDKDGAGVNMKVKKSSIKLPWELQFMFNEQPLENPDEDDMDDDEREANMATLKRLKMADDRTRGMTKEEYVHWSDCRQASFTFRKSKRFKDWSGISQLIDSKPHDDVIDILGFLTFEIVCAITETALKIKTRYERIRSMKTQSQPQEYSVGTTRRKKRLFDGPDNVVNPLKPEHIEEAWRVLQTVNMKHRALSNYKGGRLSSRTVIM

spt3

SAGA complex subunit spt3

307 amino acids

Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. SAGA is involved in RNA polymerase II-dependent transcriptional regulation. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (spt3, spt8 and spt20) and promoter selectivity, interaction with transcription activators (gcn5, ada2, ada3 and tra1), and chromatin modification through histone acetylation (gcn5) and deubiquitination (ubp8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Spt3 is required for recruitment of TATA-binding protein (TBP) to SAGA-dependent promoters. During SAGA-mediated transcriptional inhibition, spt3 and spt8 prevent binding of TBP to the TATA box (By similarity). SPT factors 3, 7 and 8 are required for the initiation of Ty transcription from the delta promoter. Spt3 regulates Ty1 as well as the mating factor genes.

Belongs to the SPT3 family.

35.633 kDa

MTETGRTSKYRVEIQQMMFILGEVQDPLPETTQLVEELIRGQVMEMLIQANELALRRGSRSITVEDLFFLIRHDRAKVNRLKTYLSWKEVRKKAKEQDANPADTKDLFEEVDSKTRSMNAVAMPWEVKNMFTEPVPETEEFEEDNDTMEMAYATRQRLKMADERTKKMTREEYVHWSECRQASFTYRKGKRFREWCGMSILTDTRPDNDIVDILGFLTFEIVATLTEEALAVKDRMDRIQNSSGSGGSHAAHHPKNCSLFDGLTEGRTPLQVSHVLEAFRRLQIPDKTHTAMRSFHGGLVKSRVYLI