Sprr2f

Small proline-rich protein 2F

76 amino acids

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).

Belongs to the cornifin (SPRR) family.

8.271 kDa

MSYQEQQCKQPCQPPPVCPPPKCPEPCSPSVCPEPCPPPKCPEPCPEPCPPPSFQQKCPPVQPPPPCQQKCPPKSK

SPRR2F

Small proline-rich protein 2F

72 amino acids

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).

Belongs to the cornifin (SPRR) family.

7.805 kDa

MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK