SNAPC5

snRNA-activating protein complex subunit 5

98 amino acids

Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box (By similarity).

11.348 kDa

MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRREGEMLPSQPAPEPSHDMLVHVDNEASINQTALELSTRSHVQEEEEEEEEEEEDS

SNAPC5

snRNA-activating protein complex subunit 5

98 amino acids

Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

11.328 kDa

MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS

Snapc5

snRNA-activating protein complex subunit 5

98 amino acids

Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box (By similarity).

11.34 kDa

MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMINSRGRTETLSSQPAPEQLCDMSLHVDNEVTINQTTLKLSTRSPMEEEEEEEEEEESDS